KEGG   Taeniopygia guttata (zebra finch): 100222335
Entry
100222335         CDS       T01082                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu04010  MAPK signaling pathway
tgu04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100222335 (TGFA)
   04012 ErbB signaling pathway
    100222335 (TGFA)
SSDB
Motif
Pfam: DUF1180 FAM176
Other DBs
NCBI-GeneID: 100222335
NCBI-ProteinID: XP_032608291
LinkDB
Position
22
AA seq 164 aa
MAGGPAALALGVLLAACHALDNSTAGRSAPVAAAVRSHFHECPDSHRQFCFHGTCRFLVQ
EEKPACVCHSGYVGTRCEHADLLAVVAATQKKQTITALLVVAVVASALLVTVCVLVHCCR
LRKRCPCPCPCPCPGWCREPGAGPEKPGGLLKGGASCCHSDTGV
NT seq 495 nt   +upstreamnt  +downstreamnt
atggcgggcggcccggccgcgctcgccctcggtgtcctgctggccgcctgccacgcgctg
gacaacagcacggccggccggagcgccccggtggcggcggccgtgcggtcgcacttccac
gagtgccccgactcgcaccggcagttctgcttccacggcacctgccgcttcctggtgcag
gaggagaaacccgcctgcgtgtgtcactcggggtacgtggggacacgctgtgagcacgct
gacctgctggccgtggtggcagccacccagaagaagcagaccatcacggccctgctggtg
gtggccgtggtggcctcggcgctgctcgtcaccgtctgcgtcctggtgcactgctgccgc
ctgcggaagcgctgtccgtgtccctgtccctgtccctgtcccggttggtgccgcgagccc
ggagccggccccgagaaaccgggggggctgctcaaggggggagcgtcctgctgccacagc
gacacaggtgtgtga

DBGET integrated database retrieval system