KEGG   Taeniopygia guttata (zebra finch): 100222904
Entry
100222904         CDS       T01082                                 

Gene name
KMT5B
Definition
(RefSeq) histone-lysine N-methyltransferase KMT5B isoform X1
  KO
K11429  [histone H4]-N-methyl-L-lysine20 N-methyltransferase [EC:2.1.1.362]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00310  Lysine degradation
tgu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100222904 (KMT5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tgu03036]
    100222904 (KMT5B)
Enzymes [BR:tgu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.362  [histone H4]-N-methyl-L-lysine20 N-methyltransferase
     100222904 (KMT5B)
Chromosome and associated proteins [BR:tgu03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100222904 (KMT5B)
SSDB
Motif
Pfam: SET DUF3970
Other DBs
NCBI-GeneID: 100222904
NCBI-ProteinID: XP_002199524
Ensembl: ENSTGUG00000009927
UniProt: H0ZI28
LinkDB
Position
5
AA seq 853 aa
MKWLGESKNMVVNGRRSGSKSSNDHAQTKLQHAGKENPKTGKNGVERRSSRCSGASGFEG
QSRYVPSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTRFRPIKGRQEELKEVIERFK
KDEHLEKAFKSLTSGDWARHYFLNKNKMQERLFKEHVFIYLRMFATDSGFEILPCNRYSS
EQNGAKIVATKEWKRNDKIELLVGCIAELSEMEENMLLRHGENDFSVMYSTRKNCAQLWL
GPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEYCECYTCE
RRGTGAFKSRVGLPAPTPVINSKYGLRETDKRLNRLKKLGDSSKNSDSQSVSSNTDADTT
QEKGNATNRKSSIGVKKNSKNRTLTRQSISRIPASSNSTSSKLTHINNSRVPKRLKKPAK
PLLSKIKLRNQCKRPEQKNASRKLEMGNLVLKEPKVVLYKNLPIKKDKELEGPVKVAVSS
GCLTRHAAREHKLNSVKGAYEHGGIAPCTYITRRSMRTRMSLKETSDTKLEPNTLDSYQS
NLTGTQSDIAEQQSRALNNNVAHGPSHKGEGRCQKSDAGTSKKKSRQGKLVKPSSKTEES
DTMHNTPVKDEVPDLISSHSELEERNNVVDAPVGFKDCVPGSGGCSVTTDNFKAKDSFRT
AKSKKKRRITRYDAQLILENSSGIPKLTLRRRHDSSSKANDQESDGMNSSKISIKLSKDH
EKDNNLYVAKLNNGFNSGSGNSSTKLKIQLKREDENRGAYSEDLHENGVCCSETLSLLES
RMEVDDYGHYEEETADESSSEEDDEEEDDYDDEFDDFIPLPPAKRLRLIVGKDSIDIDIS
SRRREDQSLRLNA
NT seq 2562 nt   +upstreamnt  +downstreamnt
atgaagtggctgggagaatccaagaacatggtagtgaatggccggagaagtggaagcaag
tcatctaatgaccacgcacagaccaaattgcagcatgcaggaaaggagaatccaaagacg
ggcaaaaatggagttgagagaagatcaagcagatgtagtggtgcttcaggatttgaggga
caaagtcgttatgtgccttcctctggaatgtctgccaaggaactctgtgaaaatgatgac
ctagcaactagtttggttcttgatccctatttaggttttcagacacacaaaatgaatact
agatttcgacctattaaaggaaggcaagaagaactcaaagaggtgattgaacgttttaag
aaagatgagcacttagaaaaagccttcaagtccttgacgtcaggtgactgggcccggcac
tattttcttaacaagaacaaaatgcaggaaaggttgttcaaggaacatgtatttatttat
ttacgaatgtttgcaactgacagtgggtttgagatactgccttgtaatcggtattcttct
gagcaaaatggagccaaaattgttgcaacaaaagaatggaaacgaaatgataaaatagaa
ttacttgtgggctgtattgctgaactatcagaaatggaagaaaacatgctgctgagacat
ggagaaaatgacttcagtgtcatgtattccacacgaaaaaactgtgcacaactatggctt
ggtcctgctgcatttatcaatcatgattgcagacctaactgtaagttcgtatcaacaggc
agagatacagcatgtgtgaaagctctaagagatattgaacctggagaagaaatctcttgt
tactacggagatgggttttttggagaaaataatgaatactgcgaatgttacacctgtgaa
agacgtggaactggtgcttttaaatcaagagtgggattgccagcacctactcctgtgatt
aacagtaaatatggactgagagaaacagacaaacgattgaacagacttaaaaagttgggt
gacagcagcaagaattcagacagccagtccgtcagttctaacactgatgcagataccact
caggaaaaaggtaatgcaactaacagaaaatcttcaattggtgtaaaaaagaacagcaaa
aatagaacattaaccagacagtctatatcaagaattccagcatcatcaaactctacctca
tctaaactaactcatataaataattccagggtaccaaagagactgaaaaagcctgcaaag
cctttactttcaaagataaagttgagaaatcagtgcaaaaggccagagcaaaagaatgct
tctcgaaagcttgaaatgggaaatttagttctcaaagagcctaaagtagttttgtataaa
aacttgcccattaaaaaggataaagaattggagggaccagtcaaagttgcagtctctagc
ggatgcttgacgaggcatgcagcaagagaacataaactgaattctgtgaaaggtgcttat
gagcatggtggtattgcaccctgcacatacatcacgaggaggtcaatgagaaccaggatg
agtttgaaggagacctctgacacaaagcttgaaccaaatacattggatagctatcagagt
aacttgactggaacacaatcggacattgcagagcagcagtctcgtgcactaaacaacaat
gtggctcatggaccatcacataaaggagagggtcggtgccagaaaagtgatgcaggcaca
tcaaaaaagaaatctcgacaaggaaagcttgtgaaaccatcttcaaagacagaggaaagt
gatactatgcacaacacgcctgtgaaggatgaagtaccagatctgattagttctcattca
gaacttgaagagaggaataatgtggtggacgcacctgttggctttaaagactgtgtccct
ggatctggtggctgctctgtaacaactgacaattttaaagcaaaagacagctttagaact
gcaaaaagtaaaaagaaaagacgaatcacgaggtatgatgcacaacttatcctcgaaaat
agctctgggatccctaaactgactcttcgtaggcgccatgatagcagtagcaaggcaaat
gatcaagagagcgatggaatgaattcttcaaaaataagcataaaattaagtaaagaccat
gaaaaagataataatttatatgtagcaaagctaaataatgggtttaactcaggatcaggc
aatagttcaacaaaattaaaaatacagctaaaacgagaggacgaaaacagaggggcatac
tcggaggaccttcatgaaaatggtgtgtgttgtagtgaaactctctcccttttggagtca
agaatggaagtagatgattatggtcactatgaagaggaaacagcagatgaatcttcatca
gaagaggatgatgaagaggaagatgactatgatgatgaatttgatgactttattcctctt
cctccagcgaagagattaaggcttattgttggcaaggattcaatagatattgatatttct
tccaggaggagagaagatcagtctctaaggctcaatgcataa

DBGET integrated database retrieval system