KEGG   Taeniopygia guttata (zebra finch): 100222972Help
Entry
100222972         CDS       T01082                                 

Gene name
GANC
Definition
(RefSeq) glucosidase alpha, neutral C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00052  Galactose metabolism
tgu00500  Starch and sucrose metabolism
tgu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100222972 (GANC)
   00500 Starch and sucrose metabolism
    100222972 (GANC)
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100222972 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 NtCtMGAM_N DUF5110 POC3_POC4
Motif
Other DBs
NCBI-GeneID: 100222972
NCBI-ProteinID: XP_002199113
Ensembl: ENSTGUG00000011075
LinkDB All DBs
Position
5
AA seq 914 aa AA seqDB search
MEAGTPGGVSVLDEAVDKRNYKKCNQIAFYRRQKLLHPGKSLYRVLLDSVTLSDESVKFH
IIHEENKVLLQVEIYEIEGNIFRLKIDEASPLRARYKVPDVLIKEPTTQRLFISNKEAGI
LVLSSVNEDYRLRVTANPFQVELQSKGETVMSVNSNGLLYFEHLQPPPSDRKHTAQNEEA
ASDSSKEKQEDLGLWEEKFDSFLDIKAHGPTSVGMDFSLHGYDHVYGIPQRTETLLLKNT
SDGDAYRLYNLDIFGHKIHEKIGIYGSVPLLLAHKPDRTSGIFWLNSSETLVDISTKAVA
EHTPSRSAAETAKQRAVPLTDVRWMSESGIIDVFLLMGPTPFDIFKQFAQLTGTQALPPL
FSLGYHQCRWNYEDEQDVKEVDAGFDAHDIPYDVIWLDIEHTDGKRYFTWDKEKFQNPRK
MQEHLRKKKRKLVVIVDPHVKVDPSYTLYAQAKEKGYFVKDRNGQDFEGICWPGSSCYLD
FTNPEVRKWYADQFAFKTYKASTNILFVWNDMNEPSVFKGAELTMQKDAVHYNNWEHREV
HNLYGFYQQMATAEGLIRRSSGKERPFVLTRSFFAGSQKYGAVWTGDNTAEWSYLKISIP
MLLTINMAGISFCGADVGGFIGDPEPELLVRWYQAGAYQPFFRGHSNLESKRREPWLFGE
KNTQLIRRAIRERYILLPYLYTLFYRAHTAAEPVMRSLWIEFPEKTETFDLENEYMMGNA
LLVHPVTEKEAKTVTVLFPGSEEIWYDFRKFKRMEDAGTVKIPVTLENIPVFQRGGTVIP
LKTRAGKSTEWMIDISYELRVALDTEACAIGELYIDDGHSFQYLHKKQFLYRKFTFHKNI
LSSSCIDESGQYHTTCVVERVIILGFGKQPTFVTASAKDGKKKEVVFTYDTKTSALTLEN
LALSVEADWEICIS
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atggaggcggggacgccggggggagtcagtgtcctagatgaggctgtggacaaaagaaac
tataagaaatgcaaccagattgctttttacaggcgtcagaagcttctacatcctggaaaa
tccttgtatcgagtcttgttggattcagtcacattaagtgatgagagtgtcaaattccat
atcattcatgaggagaataaggttcttctgcaagtagaaatttatgaaatagaaggcaat
attttcaggcttaaaattgatgaggcatctcctctcagagcaagatacaaagttcctgat
gttcttataaaggaacctaccacccagagactgttcatatccaataaggaggcaggtatt
ttggtactgtcaagtgttaatgaagactacagacttcgagtcacagcaaaccccttccaa
gttgagctgcagtccaagggtgagactgttatgagtgtgaattccaatggtttgttgtat
tttgagcatctacaaccacctcccagtgacagaaaacatacagcacaaaatgaggaggca
gcaagtgattcctctaaggaaaaacaagaggacctaggtctctgggaagagaaatttgac
agtttcttggacatcaaagctcatggtcctacatctgtaggcatggacttctctttacat
ggatatgaccatgtttatggaataccacaacgcacagaaacacttcttctcaaaaacacc
agtgatggtgatgcctaccggctttataatttggatatttttggccacaagatccatgaa
aaaataggtatttatggttcagtaccccttctcttagcacacaagcctgacagaacttca
gggatcttctggctgaactcttcagaaacactggtggatatcagtacaaaggcagtagct
gagcacactccatccagatctgctgcagagactgctaagcagagagcagtgcctctaact
gatgtacgctggatgtcggaaagtgggatcattgatgttttcctgctgatgggacccact
ccatttgatatcttcaagcagtttgcacaactgacaggcactcaagccttgcccccactt
ttttctctgggctaccatcagtgcaggtggaattatgaggatgaacaagatgtcaaggaa
gtggatgctggctttgatgcacatgatattccttatgatgtcatatggctggatatagag
cacacagatggcaagaggtattttacttgggacaaagagaaattccagaaccccagaaag
atgcaagaacatctcaggaagaaaaaacgcaagcttgtggtcatcgtagatcctcacgtt
aaggttgatccctcatataccctgtatgcacaggcaaaagaaaagggttattttgtgaaa
gacagaaatgggcaagattttgagggcatctgttggccaggttcctcttgttacctggat
tttaccaatcctgaagtgcgaaaatggtatgcagatcaatttgccttcaaaacatacaag
gcatccactaatatcctctttgtatggaatgatatgaatgagccttcagtcttcaagggg
gcagaactaacaatgcagaaagatgctgtccactacaacaactgggagcatcgggaagta
cacaacctctatggattctaccagcaaatggcaactgcagaaggactcatcaggcgttct
tcgggaaaagagagaccgtttgtcctcacacgatctttctttgctggatcacagaagtat
ggggcagtgtggactggagacaacacggcagagtggagttacttgaaaatatccattcca
atgcttcttaccatcaacatggcagggatttcattctgtggagctgatgtgggagggttt
attggagatccagagccagagttacttgttcgctggtatcaggcaggagcctaccagccc
ttcttcagaggtcactctaacctggagagcaaacggcgcgaaccgtggctctttggggag
aagaacacccagctcatcaggagagccattagagagcgctacatcctcctgccctactta
tacactctgttctatcgggcacacacggcggctgaaccggtcatgaggtctctctggata
gagtttccagagaaaacagaaacttttgatctggaaaatgagtacatgatgggaaatgct
ttgttggtacatccagtcacagagaaagaggccaagacagtgacagttctgtttccaggg
tcagaggagatttggtatgatttcagaaaatttaagcgaatggaagatgcaggcacagtg
aagatcccagtaacactggaaaatattcctgtgttccagcgggggggcactgtgatacct
ctgaagaccagagctggaaaatccactgaatggatgatagatatttcttatgaactccgc
gtggccttagacacagaggcctgtgccataggcgagctgtacatagatgatgggcattca
tttcaatatctccacaagaagcagttcctgtatcggaaattcactttccacaagaacatt
ctctcttccagctgcatagatgaaagtggacaataccacactacatgtgtagttgaacgg
gtgataattctgggatttggaaagcaacccacttttgtgacagccagtgccaaggatggt
aaaaaaaaagaagtggttttcacatatgacacgaagacctctgcactgacactggaaaac
ttagccctgagtgttgaagctgactgggagatctgtatcagctga

DBGET integrated database retrieval system