KEGG   Taeniopygia guttata (zebra finch): 100223885Help
Entry
100223885         CDS       T01082                                 

Gene name
TGM2
Definition
(RefSeq) transglutaminase 2
  KO
K05625  transglutaminase 2 [EC:2.3.2.13]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100223885 (TGM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 100223885
NCBI-ProteinID: XP_002195997
Ensembl: ENSTGUG00000006260
LinkDB All DBs
Position
20
AA seq 689 aa AA seqDB search
MAEDLVLETWDLHCDRNGREHRTAAMGCGQLVVRRGQPFAITLRFSGRAYDEAVDKLSFN
VETGPYPSETSGTSSHFVMTDCPEESCWSAVIQQQEGESLSVSLCSPANACIGRYRLTLE
TCTDYQGSSYQIGDFILLFNPWHPEDTVFMRDENERREYVLSQDGLIYQGTCDYIYSIPW
NFGQFEDEVLAICLNMLDINPKHLRDQNQDCSRRNDPVYIGRVVSAMVNCNDEDRGVLFG
RWDNCYDDGMSPMAWIGSVDILKRWKKFGCQPVKYGQCWVFAAVACTVMRCLGIPSRVVT
NYNSAHDTNANLTIDRYVNENGEQERQSWDKIWNFHCWLESWMARPDLAAGYDGWQVLDP
TPQEKSEGIYCCGPAPVKAIKEGDMLLKYDIPFIFAEVNADVVYWVVQGDGMQKQSIRSS
DVGKNISTKSIGRDSREDITHNYKYPEGSEEERAVFEKAEHQKKSIGEEDEGLHLRIKVS
EGANKGSDFDVFAVVTNNTDEECVCRVTLCARAASHNGTLGPQCGLTDQVDMDIEPRAEK
RVPLRILYEEYRDKLTQDNLIKVVALLKDHQTGDIIVAVRDIYVENPPIKIRILGEPMQN
RKLVAEISLVNPLTVPLNGCVFVVEGTGLTEGQLVKELEEPVEPQAEAKFRMDLMPRLTG
LQKLMVDFESDHLTGVKGYRNVIIAPQPM
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagatctggtgctggagacgtgggacctgcactgcgaccgcaacgggcgggag
caccgcacggcggccatgggctgcgggcagctggtggtgcggcggggacagcccttcgcc
atcaccctgcgcttctcaggccgcgcctacgacgaggccgtggacaaactctccttcaac
gtggagaccggaccctaccccagtgagacatcaggaaccagctcccactttgtcatgact
gactgcccagaggagtcgtgctggagtgctgtgatccagcagcaggagggggagtccctc
tctgtgtcgctctgctccccagccaacgcttgcatcggccgctacaggctgaccctggag
acctgcaccgactaccagggctccagctaccaaatcggggacttcatcctgctcttcaac
ccctggcacccagaggacacagttttcatgcgtgacgagaacgagcgacgtgagtacgtc
ctgtcccaggatgggcttatctaccagggcacctgtgattacatctactccatcccctgg
aacttcggccagtttgaggatgaggtcttagccatctgcctcaacatgctggacataaac
cccaagcacctgcgggatcagaaccaggactgctcgcgccgcaatgaccccgtgtacatc
ggcagggtggtgagcgccatggtgaactgcaatgacgaggaccgaggagtgctgtttggg
cggtgggacaactgctacgacgatgggatgagccccatggcttggattgggagtgtggat
attctcaagaggtggaagaagtttggatgccagccagtcaagtacggccagtgctgggtc
tttgctgctgtggcgtgcactgtcatgaggtgcctgggaatccccagccgggtggtgacc
aactacaactcagcccacgacacaaatgccaacctgaccattgaccgctacgtcaatgag
aatggggagcaggagaggcagtcctgggacaagatctggaacttccactgctggctggag
tcgtggatggcccgtccggacctggcagctggctacgatgggtggcaggtgctggacccg
acgcctcaggagaagagtgaaggaatttactgctgtgggcctgcccccgtcaaagccatc
aaagagggtgacatgctgctcaagtacgacatccccttcatctttgcggaggtgaacgcc
gacgtggtgtactgggtggtgcagggcgacgggatgcagaagcagagcatccgatcctca
gacgtggggaagaacatcagcaccaagagcattggcagggacagccgggaggacatcacc
cacaactacaagtacccggaggggtctgaggaggagcgggcagtgtttgagaaggcagag
catcagaagaagtccatcggggaggaggatgaggggctgcacctcaggatcaaggtctca
gagggcgcaaacaagggcagcgacttcgacgtctttgctgtcgtcaccaacaacacagac
gaggagtgcgtctgcagggtgacgctgtgcgcccgcgccgccagccacaacggcaccctc
gggccccagtgcggcctcacggaccaggtggacatggacattgagcccagggcagagaag
agggtgcccctgcgcatcctgtacgaagagtacagggacaaactgacccaggacaacctc
atcaaggtggtcgctctcctgaaggatcaccagactggcgacatcatcgtagctgtcagg
gacatttatgttgagaatccaccgatcaagatcaggattttaggagagccaatgcagaat
cggaagctggtggcagagatcagcctggtgaaccctctcacagtgcccctgaacggctgc
gtgttcgtggtggagggcaccggcctcaccgaggggcagctggtcaaggagcttgaggag
ccggtggagccgcaggcggaggccaaattccggatggatctgatgccgcggctgacgggg
ctacagaagctgatggtggactttgagagtgaccatctgacgggggtcaagggctaccgc
aacgtcatcatcgcaccccagcccatgtga

DBGET integrated database retrieval system