KEGG   Taeniopygia guttata (zebra finch): 100224148Help
Entry
100224148         CDS       T01082                                 

Gene name
PTEN
Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00562  Inositol phosphate metabolism
tgu01100  Metabolic pathways
tgu04068  FoxO signaling pathway
tgu04070  Phosphatidylinositol signaling system
tgu04115  p53 signaling pathway
tgu04140  Autophagy - animal
tgu04150  mTOR signaling pathway
tgu04218  Cellular senescence
tgu04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100224148 (PTEN)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100224148 (PTEN)
   04070 Phosphatidylinositol signaling system
    100224148 (PTEN)
   04150 mTOR signaling pathway
    100224148 (PTEN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100224148 (PTEN)
  09143 Cell growth and death
   04115 p53 signaling pathway
    100224148 (PTEN)
   04218 Cellular senescence
    100224148 (PTEN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100224148 (PTEN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tgu01009]
    100224148 (PTEN)
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100224148 (PTEN)
    3.1.3.48  protein-tyrosine-phosphatase
     100224148 (PTEN)
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     100224148 (PTEN)
Protein phosphatases and associated proteins [BR:tgu01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    100224148 (PTEN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 100224148
NCBI-ProteinID: XP_030131595
Ensembl: ENSTGUG00000004977
LinkDB All DBs
Position
6
AA seq 403 aa AA seqDB search
MTAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSK
HKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVA
AIHCKAGKGRTGVMICAYLLHRGKFLRAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSY
LLKNHLDYRPVALLFHKMMFETIPMFSSGTCNPQFVVYQLKVKIFTSPSGPSRREDKYMY
FEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIGLDENSDKVENGSLVADQEL
DGIFSTERSDNDKEYLILTLTKNDLDKANKDKANRYFSPNFKVKLFFTKTVEEPSNPEAS
SSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEDQHTQITKV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccatcatcaaagagatcgtcagcaggaacaaaaggcgataccaggaggatggc
ttcgacctggacctgacctatatttatccaaacataattgctatgggctttcctgcggag
aggcttgaaggagtgtaccggaacaacattgatgatgtagtaaggtttttggattcaaag
cataaaaaccattacaagatatacaatctatgtgctgaaagacattatgacaccgccaaa
tttaactgcagagttgcacagtacccttttgaagaccataacccaccacagctggagctc
atcaaacctttttgtgaagatcttgaccagtggctaagtgaagatgacaatcatgtggca
gcaatccactgtaaagctggaaagggacgaactggtgtaatgatttgtgcatatttgttg
catcgaggcaagtttttaagggcccaagaagccctagatttctatggggaagtaaggacc
agagacaagaagggagtgacaattcccagtcagagacgctacgtgtactactatagctac
ctgttaaagaatcacctggattacagaccagtggcactgctgttccacaagatgatgttt
gaaacaattcccatgttcagcagcggaacttgcaatcctcagtttgtggtgtaccagcta
aaggtaaagatattcacctccccttcaggaccctcgcgacgtgaagacaagtacatgtac
tttgaattccctcaacctttgccggtatgcggtgatatcaaagtggaattcttccacaaa
cagaacaagatgttgaaaaaggacaaaatgtttcacttttgggtaaatacattcttcata
ggactggatgaaaattcagacaaagtagaaaatggaagtctagttgcagatcaggaactt
gatggtattttcagtacagagcgctcagataatgataaggaatatttaatccttacatta
acaaaaaacgatctagacaaagcaaataaagacaaagccaacagatatttctctccaaac
ttcaaggtgaagctatttttcacaaaaacagtagaagagccatcaaacccagaggctagc
agttcaacttctgtaacaccagatgttagtgacaatgaacctgatcattatagatactct
gacaccactgactctgatccagagaatgaaccttttgatgaagatcagcatacgcagatt
acaaaagtctga

DBGET integrated database retrieval system