KEGG   Taeniopygia guttata (zebra finch): 100224907Help
Entry
100224907         CDS       T01082                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase E-like
  KO
K05620  transglutaminase 3 [EC:2.3.2.13]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100224907
Enzymes [BR:tgu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100224907
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core DUF2393 A2M_N
Motif
Other DBs
NCBI-GeneID: 100224907
NCBI-ProteinID: XP_002191322
Ensembl: ENSTGUG00000005513
LinkDB All DBs
Position
20
AA seq 688 aa AA seqDB search
MAAATQPRTDWHLKENAREHHTSKFSSEELIVRRGQAFTITFNGTERPEQNLIFIAETGP
KPSKATKTLATFDISSTVSKEGWSAVLQSSSSSSVSISISSPHNAVIGRYRLSVQSGSSS
PHNLGTFVLLFNPWSSGDDVFMPNKAECEEYVLEEFGIIFAGNKNHINSFGWNFGQFQGD
ILNICLSIMDRSLYYRQDPLTDVAHRHDPRYLGRVLSAMVNANDDQGVVLGNWSGKYEGG
KNPTSWTGSGEILQSWKKSGFRPVKYGQCWVFAAVLTTVLRCLGIPTRTITNFSSAHDAD
GNLRVDEFYDADGNHLERGADSVWNFHVWNESWFTRNDLGPSYSGWQVLDATPQEESGGI
YQCGPTSRHAVKEGEVELDYDGPFVFAEVNADCMYWNYDSATGKKTLIFSKSTEIGASIS
TKAVGRDDRVDVTRDYKYEEGSAKEREIFKKARKKLGLEDKFDPTAPKQEEVEQKPDISG
KFKVAGSLEVGKDVNLLLVLENLQSDAKTVHVNMTAWSTLYTRRRVNQIWKDSISVTLAP
KEEKQFPIKIKYPEYQQQLTTDKTIQVTALCHVEDGMQVLVKRNITLDNPAIDIQVLGEA
KVNKEVFVEVTFTNPIDEEMKDCMLQVEGSDLLQGILELRIPPLKASEKSSTKFKLIPSE
AGPKHLLVNFSCDKFADIKTFKMVNVIN
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgcaacgcagccaagaactgactggcatctgaaagaaaatgcaagagaacac
cacacaagtaaattttctagtgaagaactgattgtgaggagaggacaggccttcactatc
accttcaatggaacagaacggcctgagcaaaacttaatattcattgcagaaacaggtcca
aaaccctcaaaggcgaccaagaccctggccacgtttgatatctccagcacagtgagcaag
gagggctggagtgcagttctacagtccagcagctccagctctgtgagcatctccatttcc
agcccacataatgctgtcattggacgttacaggctcagtgttcaaagtggcagctcctct
ccacataatcttggcacttttgttttgctttttaacccttggtcttcaggtgatgatgtg
ttcatgcctaacaaggctgagtgtgaggaatatgtgctagaagagtttggcatcattttt
gcaggcaataaaaaccatatcaacagctttggatggaactttggccagtttcaaggagac
atcctcaatatttgcctgtccataatggatcgcagcctgtactaccgtcaggatcctctc
actgacgtggctcaccgacacgaccccaggtacctgggccgtgttctcagtgccatggtc
aacgccaatgatgaccaaggggtggtgctaggaaactggagtggaaaatatgagggtggt
aaaaatcccaccagctggacaggaagtggtgaaatcctgcaaagctggaagaaatcagga
ttccgacctgttaaatatggacagtgttgggtttttgcagcagtattgactacagtgctt
agatgtctggggattcccacccgtacaattacaaacttcagttctgcccatgatgcagat
ggaaatctgcgtgtggatgagttttatgatgcagatggaaatcatttggaaaggggagct
gacagcgtgtggaatttccatgtctggaatgaaagctggtttacacgcaatgacttgggc
ccctcatacagtggatggcaagttctggatgcaactccccaagaagaaagtggaggaatt
tatcagtgtggtcctacctcacggcacgccgtcaaagaaggagaagtagaactggactac
gatggcccatttgtgtttgcagaagtgaatgctgactgtatgtactggaattatgactct
gcaactggaaagaaaactttgatattctctaagtctacagaaattggtgcctccatcagt
acaaaggcagttggtagggatgatcgtgtagatgtcaccagggattataaatatgaggaa
ggctctgcaaaagaaagagaaatttttaaaaaagcccgtaagaagctgggacttgaggat
aaatttgatcctacagcaccaaaacaagaggaagttgaacagaagcctgacatctcagga
aaattcaaggtggcaggctctttagaagttggcaaagatgtcaacctacttctggttctt
gaaaatttgcagtctgatgctaagactgtacatgtaaatatgactgcatggagtactctg
tatactagaagacgagttaatcagatctggaaggactccatatctgtcactctggcccca
aaggaagagaaacaatttcccattaagataaagtatcctgaataccagcagcagttaact
acagacaaaacaatccaggtcacagctttatgtcatgtagaagatgggatgcaagtgctt
gtgaaaagaaacatcaccctggacaatcctgccatcgacatacaggtacttggtgaagcc
aaagtgaataaagaggtgtttgtggaggtgacatttaccaatcctatcgatgaggagatg
aaggactgcatgctgcaggtggagggcagtgacctgctccaaggcatcctggagctacgc
ataccaccactgaaagccagtgagaaatccagtaccaagtttaaacttatcccttctgag
gcgggtcccaaacatctacttgttaatttctcctgtgacaaatttgcagatatcaagacc
tttaagatggtaaatgtgattaattaa

DBGET integrated database retrieval system