KEGG   Taeniopygia guttata (zebra finch): 100225713
Entry
100225713         CDS       T01082                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand isoform X1
  KO
K05461  KIT ligand
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu04010  MAPK signaling pathway
tgu04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100225713 (KITLG)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100225713 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:tgu04052]
    100225713 (KITLG)
Cytokines and growth factors [BR:tgu04052]
 Growth factors
  Growth factors (RTK binding)
   100225713 (KITLG)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 100225713
NCBI-ProteinID: XP_030116852
Ensembl: ENSTGUG00000008039
LinkDB
Position
1A
AA seq 285 aa
MKKAQTWIITCFCLQLLLLNPLVKAQSSCGNPVTDDVNDIAKLVGNLPNDYMITLKYVPK
MDSLPSHCWLHLMVPEFSRSLHNLLQKFSDIPDMSDVLSNYSIINNLTRIINDLMACLAF
DKNKDFVKENGHLYEEGHFIPEDFFRHFNSTIEVYKESADRLDKNDCILPSTVGTPENDS
RVAVTKTFLFPPVAASSLRNDSIGSSTSSNKEALGFISSSSLQGISIALTSLLSLLIGFI
LGAIYWKKIHPKSRPESDETTQCRDYQEENEISMLQQKEKEHLQV
NT seq 858 nt   +upstreamnt  +downstreamnt
atgaagaaggcacaaacttggattatcacttgcttttgtcttcaactcctcctacttaat
cctcttgtcaaagcccaaagttcctgcgggaatccagtcacagatgatgtgaatgacatt
gcaaaattggttggaaatctcccaaatgattatatgataacccttaaatatgtcccgaag
atggatagtctgcctagtcactgttggttgcatttgatggtgcctgaattttcaaggagt
ctacataatcttctccagaaattttcagatattccagatatgtcagatgttttaagcaac
tattcaatcatcaataatctcacaagaataattaatgatcttatggcatgccttgctttt
gataaaaacaaggattttgtgaaagaaaatggtcacctttatgaagagggtcacttcatt
cctgaggatttttttaggcactttaatagtaccattgaggtctacaaagagtctgcagac
agattggataagaatgactgcattctgccttcaacagtaggaactccggagaatgattcc
agagtcgctgtcacaaaaacatttttgtttcctcctgttgctgccagctctcttaggaat
gacagcattggcagtagcactagcagtaacaaagaagcacttggcttcattagcagctcc
agcctgcaagggatcagcatagcactgacatcattgctgtctctccttattggctttatt
ttgggagccatatactggaagaaaatacatcccaaatccagaccagaaagtgatgaaact
acacagtgtcgtgactatcaggaggaaaatgagataagtatgttgcagcaaaaagaaaag
gaacatctacaagtgtag

DBGET integrated database retrieval system