KEGG   Taeniopygia guttata (zebra finch): 100226089Help
Entry
100226089         CDS       T01082                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00052  Galactose metabolism
tgu00500  Starch and sucrose metabolism
tgu01100  Metabolic pathways
tgu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100226089
   00500 Starch and sucrose metabolism
    100226089
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100226089
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tgu04147]
    100226089
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100226089
Exosome [BR:tgu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100226089
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 100226089
NCBI-ProteinID: XP_012433317
Ensembl: ENSTGUG00000008237
LinkDB All DBs
Position
14
AA seq 925 aa AA seqDB search
MKSYQKLTTAQPAACRVEEEGAAPMPSSHGKLAPWWVGSGLLVAAVLLSTITVWVLRQVS
GGWLGPTPPPKCLLVPESHRFDCYPERHVVVTQELCESRGCCFIQSPPLAEGKQGVPWCF
YPPDFPSYTLESLNQTALGMVGLLVRREKAYYPRDIEKLRLDVEFETDTRLHIKITDAAN
PRYEVPLDVPRVMKRAENPIYSLNFSWDPFGVLLQRKATGTVLLNTTVAPLIFADQFLQI
STSLPSKFLYGLGEHRGSLLHSLDWNTLTLWARDVPPTESLNLYGAHPFYLLIEEGGNAH
GVFLLNSNAMEVALQPAPGLTWRTIGGVLDFYIFLGPNPNMVIQQYQQVIGFPAMPPIWA
LGFHLCRWGYGSSNETWQTVRAMRNYQIPQDGQWNDIDYMDGYRDFTVDSQKFASLPSLV
EDLHKHGQHYVMILDPGISSTSPQGSYWPFDEGLRRGLFLNTTQGKPLIGQVWPGFTAFA
DFSNPGTHSGGWRPAALPCHVPFDALIVYMGKASSVMEGSVVMYPPGEKDNPPYTPAVLG
DSLSAKTVCASARQKVSVHYNLHNLYGLMEAKATASALIKIRGKRPFVISRSTFPSQGRY
SGHWLGDNRSQWKDMSYSIPGLLSFSLFGIPLVGADICGFSGSTSEELCTRWMQLGAFYP
FARNHNTQNEKAQEPAVFSPAARTAMKDVLLTRYSLLPFLYTLFHRAHLQGDTVARPLFF
EFPWDVATWELDRQFLWGRSLLVTPVLEPGVDSVTGYVPQGTWYDFYTGSSVNSSGEMLK
MSAPLEHLNLHIWEGSILPTQKPGTTTELTRGNPLRLIVALSSHATAWGDLFWDDGESLD
TFEKGNYSYVVFNVTENIFTSTVLHASTEATKVTVGTLSIFGVQKPPSKVLLNGREKPFS
YLDNQVLTVSDLGMSLSQGFSLQWL
NT seq 2778 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcgtaccagaagctgacaacagcacagccagcagcatgccgggtggaagaggag
ggggctgcccccatgccctccagccatgggaagctggccccgtggtgggtgggcagtggg
ctgctggtggccgctgttctgctgagcaccatcactgtctgggtgctgcggcaagtatcg
gggggctggctcggacccacgcccccccccaaatgtctcctggtacctgagagccatcgc
ttcgactgctacccggagcggcacgtggtggtgacccaggagctctgtgaaagccgaggg
tgctgcttcatccagagccccccgctggcagagggcaagcagggggtgccctggtgcttc
tatccccctgacttccccagctacaccctggagagcctcaaccagacagctctgggcatg
gtggggctgctggtgcgaagggagaaggcctattacccccgggacatcgagaagctgagg
ctggatgtggagtttgagacggacacgaggctgcacatcaagataacagatgcggccaac
ccacgctatgaggttccccttgatgttccccgtgtgatgaagagagcagaaaaccccatc
tacagtctgaacttctcctgggacccctttggggtgctgctgcagcgcaaggcaacaggg
acagtgctgctaaacaccaccgtggcccccttgatctttgctgaccagtttctccagata
tccacatcactcccatccaagttcctctatgggctgggggagcaccgtggcagcctcctg
cacagcctggactggaacaccctcacgctgtgggcccgcgacgtccctcccacggagtca
ttgaacctgtacggcgcccaccccttctacctgctgatagaggagggtggaaatgctcac
ggtgttttcctactcaacagcaatgccatggaggtggctctgcagcctgctccaggcctg
acctggaggactattggaggagtgctggatttttacatcttcctggggcccaatcccaac
atggtcatccagcagtaccagcaggtgataggtttcccagccatgccacccatctgggct
cttggcttccacctctgccgctggggctacggatccagcaacgagacgtggcagaccgtg
agagccatgaggaactaccagatcccccaggatgggcagtggaatgacatcgattacatg
gatgggtaccgggacttcaccgtggattcccagaagtttgcttccctcccctccctggtg
gaagacctccacaaacatggccagcactacgtcatgatcttggatcctggcatcagcagc
accagccctcagggctcctactggccttttgatgaaggcttgagacggggcttgttcctc
aacaccacccaagggaagccactcatcgggcaggtctggcctggtttcactgccttcgca
gacttctccaacccaggcacacacagtggtggctggagacctgcagcacttccatgccac
gtgccctttgatgctctgatcgtatacatgggcaaggcgagctcagtcatggaagggtct
gtagtaatgtatcccccaggagagaaagacaacccaccctacactccagccgttctgggt
gattccctctctgcaaagacggtgtgtgcctcggcaaggcagaaagtctcggtgcactac
aacctccacaacctctatgggctgatggaagccaaagccacagcaagcgccttgatcaag
atccggggcaagcgcccctttgtcatctcgcgctccaccttccccagccagggccgctac
tcggggcactggctgggtgacaaccggagccagtggaaggacatgagttactcaatccca
gggctgctgagcttcagcctctttggcatcccgctggtcggggcagacatctgcggcttc
tccggcagcacctcggaggagctgtgcacccgctggatgcagctcggggccttctacccc
ttcgctcgcaaccacaacacccagaacgagaaggcccaggagccagcagtgttcagccct
gcagccaggacagccatgaaggatgtgctgctgacccgctattccctcctgcccttcctc
tacacccttttccaccgtgcccacctgcaaggggacaccgtggcccggcccttgttcttt
gagttcccctgggatgtggccacgtgggagctggacaggcagttcctgtggggccggagc
ctgctggtaacaccggtgctggaacccggggtggactcagtcacaggttacgttccccaa
ggcacgtggtacgacttctacacgggctcctcggtgaacagcagtggggagatgttgaag
atgtcggcccctctggagcacctcaacctgcacatctgggaaggttccatcctgcccacc
cagaaaccaggaaccaccacagagctgacccgagggaatcccttgcgtctcattgtggcc
ttgtcctcacatgccactgcctggggtgaccttttctgggacgatggcgagagcctggac
accttcgagaagggcaactactcctacgtggtgttcaatgtcacagagaacatcttcacc
tccaccgtcctccatgccagcaccgaggccaccaaggtcaccgttggcacactgagcatc
tttggggtgcagaaaccgcccagcaaggtcctcctgaatggccgggagaagcccttttcc
tatctggacaaccaggttctcaccgtgagtgaccttggcatgagcctcagccagggcttc
tccctgcagtggctgtga

DBGET integrated database retrieval system