KEGG   Taeniopygia guttata (zebra finch): 100226105Help
Entry
100226105         CDS       T01082                                 

Gene name
PRKACB
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta isoform X6
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu04010  MAPK signaling pathway
tgu04020  Calcium signaling pathway
tgu04114  Oocyte meiosis
tgu04140  Autophagy - animal
tgu04261  Adrenergic signaling in cardiomyocytes
tgu04270  Vascular smooth muscle contraction
tgu04310  Wnt signaling pathway
tgu04340  Hedgehog signaling pathway
tgu04371  Apelin signaling pathway
tgu04530  Tight junction
tgu04540  Gap junction
tgu04910  Insulin signaling pathway
tgu04912  GnRH signaling pathway
tgu04914  Progesterone-mediated oocyte maturation
tgu04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100226105 (PRKACB)
   04310 Wnt signaling pathway
    100226105 (PRKACB)
   04340 Hedgehog signaling pathway
    100226105 (PRKACB)
   04371 Apelin signaling pathway
    100226105 (PRKACB)
   04020 Calcium signaling pathway
    100226105 (PRKACB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100226105 (PRKACB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100226105 (PRKACB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100226105 (PRKACB)
   04540 Gap junction
    100226105 (PRKACB)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100226105 (PRKACB)
   04912 GnRH signaling pathway
    100226105 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    100226105 (PRKACB)
   04916 Melanogenesis
    100226105 (PRKACB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100226105 (PRKACB)
   04270 Vascular smooth muscle contraction
    100226105 (PRKACB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tgu01001]
    100226105 (PRKACB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:tgu03019]
    100226105 (PRKACB)
   03036 Chromosome and associated proteins [BR:tgu03036]
    100226105 (PRKACB)
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100226105 (PRKACB)
Protein kinases [BR:tgu01001]
 Serine/threonine kinases: AGC group
  PKA family
   100226105 (PRKACB)
Messenger RNA biogenesis [BR:tgu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100226105 (PRKACB)
Chromosome and associated proteins [BR:tgu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100226105 (PRKACB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 100226105
NCBI-ProteinID: XP_012430688
Ensembl: ENSTGUG00000006643
LinkDB All DBs
Position
8
AA seq 338 aa AA seqDB search
MNVKEFLAKAKEDFLRKWESPPQNTAGLDDFERQKTLGTGSFGRVMMVKHKSTEQYYAMK
ILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEYSFKDNSNLYMVMEYVPGGEMFSHL
RRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVK
GRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVS
GKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKNHKWFATTDWIAIYQRKVEA
PFIPKCRGPGDTSNFDDYEEEDIRASLTEKCAKEFADF
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgaaagagttcctagccaaagccaaagaagactttttaagaaaatgggaaagc
ccccctcagaatactgctggcctagatgattttgagcggcaaaaaacccttggaacagga
tcatttgggagagtaatgatggtgaaacataaatccacagaacagtattatgctatgaag
atactggacaaacagaaggtcgtcaaactgaagcagatagaacacacactgaatgagaag
aggatattacaagcagtgaactttcctttccttgttaaactggagtattcttttaaggac
aattctaatttatacatggtaatggagtatgttcctggtggagaaatgttttcacatcta
agaagaatcggaaggttcagtgaaccacatgcacggttttacgcagctcagatagtgcta
acatttgagtacctccattcattagacctcatctacagagatctaaagcctgaaaatctt
ttaattgatcagcaaggatacatccaggtcacggactttggctttgcaaaaagagtaaaa
ggcagaacttggacgttatgtgggactccagaatacctggcacctgaaataattctcagc
aagggttacaacaaggcagtggattggtgggcgctaggagtgttaatctatgaaatggca
gctggatatcccccattctttgcagatcagcccattcaaatttacgagaagattgtgtct
ggcaaggtgaggttcccatcacacttcagttcagacctaaaggatcttctaagaaattta
ctccaggtagatttgaccaaacgatatggaaatctcaagaatggtgtaaatgacataaag
aatcacaagtggtttgcaactacagattggattgccatttatcagagaaaggtagaagct
ccattcataccaaagtgcagaggtcctggagataccagcaactttgatgactatgaagaa
gaagatattcgtgcttctctaacagaaaaatgtgcaaaagaatttgctgatttttag

DBGET integrated database retrieval system