KEGG   Taeniopygia guttata (zebra finch): 100226456Help
Entry
100226456         CDS       T01082                                 

Gene name
HK1
Definition
(RefSeq) hexokinase 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00010  Glycolysis / Gluconeogenesis
tgu00051  Fructose and mannose metabolism
tgu00052  Galactose metabolism
tgu00500  Starch and sucrose metabolism
tgu00520  Amino sugar and nucleotide sugar metabolism
tgu00524  Neomycin, kanamycin and gentamicin biosynthesis
tgu01100  Metabolic pathways
tgu01200  Carbon metabolism
tgu04910  Insulin signaling pathway
Module
tgu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tgu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100226456 (HK1)
   00051 Fructose and mannose metabolism
    100226456 (HK1)
   00052 Galactose metabolism
    100226456 (HK1)
   00500 Starch and sucrose metabolism
    100226456 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    100226456 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100226456 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100226456 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tgu04131]
    100226456 (HK1)
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     100226456 (HK1)
Membrane trafficking [BR:tgu04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100226456 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_1 Hexokinase_2
Motif
Other DBs
NCBI-GeneID: 100226456
NCBI-ProteinID: XP_002191150
Ensembl: ENSTGUG00000003945
LinkDB All DBs
Position
6
AA seq 839 aa AA seqDB search
MIAAQLLAYYFTELKEDQVKKIDKYLYAMRLSDETLLDVMARFRREMKNGLSRDFNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSYFRILRVKVSHEKKQTVQMESEIYNTPEDIMH
GSGTRLFDHVAECLGDFMEKQQIKDKKLPVGFTFSFPCRQSKLDEGFLITWTKRFKASGV
EGADVVRLLNKAIKKRGDYDADIMAVVNDTVGTMMTCGFDDQRCEVGLIIGTGTNACYME
EMRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGL
YMGELVRLILVKMAKEGLLFEGRITPELLTKGKFETKHVSAIEKSKEGLNKAKEILTRLG
VEPSHEDCIAVQHVCTIVSFRSANLVASTLGAILNQLRDNKGVVRLRTTVGVDGSLYKMH
PQYARRLHKTTRRLVPDSEVRFLLSESGSGKGAAMVTAVAYRLSEQHRLIDETLAEFKLT
HEQLLQVKKRMRAEMEAGLKKKTHDTAKVKMLPTFVRSTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKRRTVEMHNKIYAIPIEVMQGTGEELFDHIVTCISDFLDYMGIKGARLPLGF
TFSFPCKQTSLDAGILLNWTKGFKATDCEGEDVVYLLREGIKRREEFDLDVVAVVNDTVG
TMMTCAYEDPNCEIGLIVGTGSNACYMEEMRNIEMVDGEQGRMCVNTEWGAFGDNGCLDD
IRTIYDKAVDDFSLNAGKQRYEKMISGMYLGEIVRNILIDFTKRGFLFRGQISETLKTRH
IFETKFLSQIESFSRIMHQTVKDLAPNCDVTFLLSEDGSGKGAALITAVGCRLREAEQN
NT seq 2520 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgcccagctcctggcctactacttcacggagctgaaggaggaccaggtcaaa
aagattgacaagtacctctacgccatgcggctgtcagatgaaacactgctggatgtcatg
gctcgcttcaggagggagatgaagaacggcctctccagggatttcaacccaacagccaca
gtgaagatgcttcccacctttgtgaggtccattcctgacggttcagagaaaggagatttc
attgcactggatcttgggggttcttacttccgaattcttcgggtaaaggtgtcgcatgaa
aaaaagcagacggtgcagatggaaagtgaaatttacaataccccagaggacatcatgcat
gggagtggaacacggctttttgatcatgttgctgaatgcctgggagactttatggagaaa
caacaaatcaaagacaagaaactaccagtcgggtttacgttttccttcccctgtcgacaa
tccaagctagatgagggttttctgataacctggacgaagcgcttcaaagcgagcggagtg
gagggagcagatgttgtgaggctgcttaacaaagccatcaagaagcgtggggactacgat
gcagacatcatggctgtggtgaacgacaccgtgggcaccatgatgacctgtggctttgac
gaccagcgctgcgaagtcggcttgatcatcggcacgggcaccaacgcctgctacatggag
gagatgaggcacatcgacctggtggagggggacgagggcaggatgtgcattaacacggag
tggggggccttcggagacgacggctcgctggaagacatcaggacagagttcgaccgagag
atcgaccgtggatcccttaatcctgggaagcagctgtttgagaagatggtcagtgggctg
tacatgggggagctggtaaggctcatcctggtgaagatggccaaggaggggctgctcttt
gaggggagaatcactcctgagcttctcaccaaagggaagtttgagacaaagcatgtttct
gccattgaaaagagcaaagagggtttgaacaaagccaaagaaatcctgacccggctgggg
gtagagccgtcccacgaggactgcatcgctgtccagcacgtctgcaccatcgtgtccttc
cgctccgccaacctggtggcctccaccctgggcgccatcctcaaccagctgcgggacaac
aagggcgtggtgcgcctccgcaccaccgtgggcgtggacggctccctctacaagatgcac
ccacagtacgcccggcgcctgcacaagaccacgcggcgcctggtgcccgactcggaggtg
cggttcctgctgtcggagagcggcagcgggaagggagcggccatggtgacggccgtggcc
taccggctgtcggagcagcaccgcctcatcgacgagaccctggccgagttcaagctcacc
cacgagcagctgctgcaggtgaagaagaggatgagggcggagatggaagcggggctgaag
aagaagactcacgacaccgccaaagtgaaaatgctgcccaccttcgtccgcagcacgccg
gatgggacagagaatggagactttctggcacttgaccttggagggacaaactttagagtt
ttgctagtcaaaatccgcagcggtaaaaggagaacagttgagatgcacaacaagatctat
gccattcccatagaggtgatgcagggaacaggagaagagctgtttgatcacattgttacc
tgcatttctgacttcctggattatatggggataaaaggagcacgtcttcctcttggcttc
accttttccttcccttgcaagcagacaagtctggatgctggtatccttctcaattggaca
aaaggcttcaaagctacagactgtgagggagaagatgtggtatatttacttagagaagga
attaaaagaagagaggaatttgacttggatgtggtggctgtggtgaatgacacagtgggc
acaatgatgacttgtgcttatgaagatccaaactgtgaaattgggctcattgtgggaacg
ggcagcaatgcctgttacatggaggagatgagaaacatcgagatggtggatggtgagcag
gggaggatgtgtgtgaacacggagtggggagccttcggggacaacgggtgcctggacgac
atcaggacaatatatgacaaagcagtcgatgacttctccctgaatgctggcaagcagagg
tatgagaaaatgatcagcgggatgtacctgggggaaatagtccgcaatattttgatcgac
ttcaccaaacggggtttcctgttccgaggccagatttcagagacactgaagaccagacat
atctttgaaaccaagttcctttctcagattgagagcttctcgaggatcatgcaccaaaca
gtcaaagatctggcacccaactgcgatgtgaccttcctgctgtcggaggacggcagcggg
aaaggggcagcgctcatcacagcggtgggatgcaggcttcgtgaggctgagcagaactga

DBGET integrated database retrieval system