KEGG   Taeniopygia guttata (zebra finch): 100228612
Entry
100228612         CDS       T01082                                 

Definition
(RefSeq) glutathione S-transferase omega-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00480  Glutathione metabolism
tgu00980  Metabolism of xenobiotics by cytochrome P450
tgu00982  Drug metabolism - cytochrome P450
tgu00983  Drug metabolism - other enzymes
tgu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100228612
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100228612
   00982 Drug metabolism - cytochrome P450
    100228612
   00983 Drug metabolism - other enzymes
    100228612
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tgu02000]
    100228612
Enzymes [BR:tgu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100228612
Transporters [BR:tgu02000]
 Other transporters
  Pores ion channels [TC:1]
   100228612
SSDB
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C GST_C_2 Glutaredoxin GST_C_5 GST_N_4
Other DBs
NCBI-GeneID: 100228612
NCBI-ProteinID: XP_002197460
Ensembl: ENSTGUG00000010435
UniProt: H0ZJJ3
LinkDB
Position
6
AA seq 242 aa
MSGDHSRSLGKGSAAPGPVPAGLIRLYSMRFCPFAQRTRLVLRAKGISHEVININLKNKP
DWYFEKNPSGLVPVLETSKGQLIWESPITCEYLDEAFPGKKLMPSDPYERACQKMLLEDF
SKITPLLFKHVLAVKDGQDTTALKAEIAEKFGKLEEVLSKRNTVFYGGDSVSMVDYMIWP
WFERLEPFQLKDSLNHTPKLQRWMEAMKEDPAIKATITDPQTYKNYLQLYLKNSPEACDY
GL
NT seq 729 nt   +upstreamnt  +downstreamnt
atgtcgggcgatcactcccgcagcctgggcaagggcagcgcggcgccgggcccggtgccc
gcggggctgatccggctctacagcatgcgcttctgccccttcgcgcagcggacgcgcctg
gtcctccgcgccaagggcatcagccatgaagtaatcaacatcaatctgaagaacaaacct
gactggtactttgagaagaacccctctgggctggttcctgttctggagaccagcaagggc
cagctgatctgggagtccccaatcacctgtgagtacttggatgaagcatttccagggaag
aagctgatgccttcagacccctatgagcgagcttgtcaaaagatgctcttggaagacttc
tcaaagataacacccttgcttttcaagcatgtgttggcagtcaaagatggacaggacacc
actgcactgaaagcagagattgctgaaaagtttggcaaacttgaagaggttctgtccaag
cgcaacacggtgttttatggtggggactcagtctcaatggttgactacatgatctggcca
tggtttgaacgtctggagccattccagctgaaagactctttgaatcacaccccaaagctc
caacgctggatggaggccatgaaggaggaccctgctatcaaggctacaataactgatcca
cagacatacaaaaactacctccagctgtatctgaagaacagccctgaggcatgtgattat
gggctctga

DBGET integrated database retrieval system