KEGG   Taeniopygia guttata (zebra finch): 100228667Help
Entry
100228667         CDS       T01082                                 

Gene name
F13A1
Definition
(RefSeq) coagulation factor XIII A chain
  KO
K03917  coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100228667 (F13A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core TssD DAGK_cat Arch_flagellin
Motif
Other DBs
NCBI-GeneID: 100228667
NCBI-ProteinID: XP_002199785
Ensembl: ENSTGUG00000002276
UniProt: H0YVP7
LinkDB All DBs
Position
2
AA seq 735 aa AA seqDB search
MSETTSTNVENKHLLNGRRAIPLNYSNDEENEVPEMEAFGLIPRGFNPRDYLSVVDIYMF
KEPHEINKQEHHTDKYYNPKLIVRRGQAFQIQIDFNRPYKPESDQFWLEFLMGRYPQQNK
GTYIPILVGNVLKPGQWGAKIIHRENNSIRLSIMSSTTCIIGKFRFYVAVMTPFGILRTR
RNSATDTYILFNPWCQLDAVYLDDEKEREEYVLNDVGIVFHGNVEDVKSRSWSYGQFEEN
VLDACLFLMDKAELELSGRGNPIKICRVASAVINSRDDNGVIAGSWNNTYDYGVAPSAWT
GSVDILLEYYSSKQPVRYGQCWVFAGVFNTFLRCLGIPARLITNYSSAHDNNANLRMDFF
LDDEGKVDTRLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQVVDGTPQETSDGMYRCGPAS
VQAIKHGHVCFQFDAPFVYAEVNSDIFYTRMEKNGTQVVENIDTTHIGQLIVTKAVGGDG
MVDITEQYKFREGSDEERLALETAVMYGVKKQSIQDTTYQPQTDVDMDFQVQKAVLGNDF
KVTITFRNKSRNSYTATTYFSGNIVFYTGVTKTEFKKHSFSAKLEPSSSSSFDIVIKSSE
YMSDLLEQASFHFFVTARINETGKILAVQKAIMLEIPTLRIKTKGELVAGKETSVIVEFT
NPLKQTLENVMLRLEGPGVLRTIKKQFGRIPMNSTLTWEVKFTPMRPGLQKLIASLNSDA
LRHVYGELNIQIRKP
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaacaacgagcaccaacgtggagaataaacatcttttgaatgggagaagagcc
atcccactaaactactccaatgatgaagaaaatgaggttcctgagatggaagcttttgga
ttgatacctagaggatttaatcctagagattacctgagtgttgtggatatttatatgttc
aaggagcctcacgagatcaacaagcaggagcaccacactgataagtactacaaccccaag
ctgatagtgcgtcggggacaggctttccagatccagattgacttcaaccgaccctacaag
ccagagtcagaccaattctggctggagtttttgatgggtcgctacccacagcaaaacaaa
ggcacctacatcccaatcctagtaggcaatgtgctaaaacctggccagtggggagccaag
attatccacagggaaaacaactccattcggctgtccatcatgtcctctaccacctgcatc
attgggaagtttcgcttctatgttgctgtcatgactcccttcggcatccttcgaacacgc
aggaattcagcgactgacacttacatcttgttcaatccctggtgccagctggatgctgtg
taccttgatgacgagaaagaaagggaagaatatgtcctgaatgatgttggtattgtattc
catggaaacgtcgaagatgtaaaatcaagaagctggagttacgggcagtttgaagaaaat
gttctggatgcttgcttgttcctgatggacaaggcagaactggagctctctggtcgtgga
aacccaatcaaaatctgccgtgttgcctcagcagtgattaactccagggatgacaacggt
gtgattgctggatcctggaacaatacgtacgattatggtgttgcaccttcagcctggacg
ggaagtgtggacattctcttggagtactacagttctaagcaacctgtccgatatggccag
tgctgggtttttgctggtgtcttcaacacatttctgagatgcttggggatacctgcaaga
ctcattaccaactattcttctgcccatgataacaatgccaatttacggatggacttcttt
ctggatgacgaagggaaagtggacaccagacttacaaaagattctgtctggaattaccat
tgctggaacgaagcttggatgactagacctgaccttcccgttggttttggaggctggcag
gttgtggatgggacacctcaagaaaccagtgatggtatgtacaggtgtggtccagcctca
gttcaagccattaaacatggtcacgtttgtttccaatttgatgctccttttgtctatgct
gaggtgaatagtgacattttttacacaagaatggagaaaaatggaacccaagtggtagaa
aacattgacacgacccatattgggcagttgattgtgaccaaggcagttggaggtgatgga
atggtggacattactgagcagtacaagttccgagaaggctcagatgaggagaggctggct
cttgagaccgctgtgatgtatggtgttaaaaagcaaagtatccaagacaccacataccag
ccacagacagatgttgacatggacttccaagtgcaaaaggcagtccttggcaatgacttt
aaagtcactataacattcaggaacaagagtcgcaactcctacactgcaactacctacttt
tcgggtaacatagtgttttatacaggagtcacaaaaactgaattcaagaaacactctttc
agtgcaaaactggaaccctcttcatccagctctttcgacattgtgatcaaatcaagcgag
tacatgagtgacctgctggagcaagcctcctttcatttctttgtgactgcacggatcaat
gaaacagggaagattctggctgtgcagaaggcaataatgctggaaattccaaccctgcgg
atcaagaccaaaggtgaactggtagctggtaaagaaacatcggtgattgtggaattcacc
aatcctctgaaacaaaccctggagaacgtcatgctccgcctcgagggacctggtgtgctg
agaacaataaaaaagcagttcgggagaatcccaatgaattctacattgacctgggaagta
aaatttaccccaatgcgaccaggcttacagaagctgattgcaagcctgaattctgatgct
ttgaggcatgtgtatggtgagctgaatatccagattcggaaaccatga

DBGET integrated database retrieval system