KEGG   Taeniopygia guttata (zebra finch): 100229661Help
Entry
100229661         CDS       T01082                                 

Gene name
GSTZ1
Definition
(RefSeq) glutathione S-transferase zeta 1
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00350  Tyrosine metabolism
tgu01100  Metabolic pathways
Module
tgu_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    100229661 (GSTZ1)
Enzymes [BR:tgu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     100229661 (GSTZ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C GST_C_2 GST_C_5 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 100229661
NCBI-ProteinID: XP_004174525
Ensembl: ENSTGUG00000012291
LinkDB All DBs
Position
5
AA seq 215 aa AA seqDB search
MASEKPILYSYFRSSCSWRVRIALALKGISYDLVPVNLIKDGGQQFSAEFKALNPMQQVP
ALKIDGITLSQSLAIINYLEEVHPNPRLLPQDPKKRAQVRMIADHIASGIQPLQNLSVLK
QMGEKKMEWAQNCITSGFQALEQILQHTAGRYCVGDEVSMADLCLVPQVANAERFKVDMG
PYPTITRINKVLLELEAFKISHPSRQPDTPAELRA
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggcatctgaaaagccaatactttacagctatttccgaagttcctgttcctggagagtg
cgaatcgcactggctctgaaaggaatttcctatgacctggtcccagtgaacctcattaag
gatggaggacagcagttttctgctgaattcaaggcactgaatccaatgcagcaagtccca
gccttgaaaattgatggcatcaccctttctcagtcgctagctataattaattacctagaa
gaggtgcatcctaaccccaggctcctgccccaagatccaaagaagagagcccaagtcaga
atgattgctgaccacattgcctctggcattcagccactccagaacctgagtgtcctgaaa
caaatgggggagaaaaaaatggaatgggctcagaactgtatcacatctggctttcaagca
ctggagcagattctgcagcacactgctggacgctactgtgtgggggatgaagtttccatg
gctgatctgtgtttagttcctcaagttgccaatgccgaaagattcaaagtggacatgggt
ccatatcccacaataaccagaataaataaagttctcttggagttagaggccttcaaaata
agccacccttcccggcagccagatactcctgcagagctgcgagcttga

DBGET integrated database retrieval system