KEGG   Taeniopygia guttata (zebra finch): 100230865Help
Entry
100230865         CDS       T01082                                 

Gene name
TMPRSS2
Definition
(RefSeq) transmembrane protease, serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    100230865 (TMPRSS2)
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     100230865 (TMPRSS2)
Peptidases [BR:tgu01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100230865 (TMPRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 Hepsin-SRCR DUF1986 Ldl_recept_a SRCR Trypsin_2
Motif
Other DBs
NCBI-GeneID: 100230865
NCBI-ProteinID: XP_012424866
LinkDB All DBs
Position
1
AA seq 501 aa AA seqDB search
MTSTLGPPPPYYENRGFQPEPLYAARLAAGANPYPQLFTSPPSVPTYVPRGPPPPYYENR
GFQPEPLYAARLAAGANPYPQLFTSPPSVPTYVPRVATHQSSRPAAPPPRRSCAAIENHC
LSSLIECGSSGVCMPPSQWCDGISDCPNGEDETRCVRLFGPNFILEVYSPVSKSWYPVCQ
DDWNDDYGKIACKDMGYSMDTYFYSRGVAPEVSFKSYMKLNTSAGNIDLYKKLYTSGSCA
SGKVVSLRCIECGLSSKSVSIMNRIVGGSGAVLGQWPWQVSLHVQGTHVCGGSIITPHWL
VTAAHCVEGRLSDPHSWRVYAGILNQDEMLFRSGYKVQQIISHPDYDTDSKDNDVALMKL
ETPLSFTETVRPVCLPNPGMMFQPNQQCWISGWGAEHQGGKTSNSLNYVAVPLIEHSRCN
AVYIYNGMILPTMICAGDLAGGIDSCQGDSGGPLVTLHHSVWWLVGDTSWGTGCATPNKP
GVYGNMTVFTDWIYKNMQANR
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgacctctactctaggtccaccaccgccatactacgagaaccggggcttccagccggag
ccgctctacgctgccaggctggcagcaggtgctaatccttacccccagctcttcaccagc
cctccctccgtgccaacctacgtccccaggggtccaccaccgccatactacgagaaccgg
ggcttccagccggagccgctctacgctgccaggctggcagcaggtgctaatccttacccc
cagctgttcaccagccctccctccgtgccaacctacgtccccagggttgccacccaccag
tccagcaggccagcagcacccccgcccaggagaagctgtgcagccatagagaaccactgt
ctcagctccctgattgagtgtggatcctcaggggtgtgcatgcccccctcccagtggtgt
gacggaatcagcgactgccccaacggggaggacgagacccgctgtgttagactttttgga
ccaaattttattctggaagtttattcacctgtcagcaaatcctggtatcctgtttgccaa
gatgactggaatgatgattatgggaagattgcatgcaaagacatgggctacagcatggat
acgtatttctacagtcgtggggtggcacctgaagtcagctttaagagctacatgaagttg
aacacaagtgctgggaatatagacttgtacaaaaagctgtacaccagtggttcctgtgcc
tcaggaaaggtggtttctctgcgctgcatagagtgtggcctgtccagcaagagcgtgagc
atcatgaacaggattgtggggggcagcggggccgtgctggggcagtggccgtggcaggtc
agcctgcacgtgcagggcacccacgtctgtgggggctccatcatcaccccacactggctc
gtgacagcagcacactgtgtggaagggcgactgtctgacccacacagctggagggtttat
gctgggattctgaatcaggatgagatgctctttagaagtggatacaaagtgcaacagata
atttcccacccagattatgacacagactctaaagacaatgatgttgcacttatgaagctg
gagacaccactgagttttactgaaactgtgaggccagtttgtctgcccaatccaggaatg
atgtttcaacctaaccagcagtgctggatatcagggtggggagcagagcaccaaggaggt
aaaacatcaaacagcttgaattatgttgcagtgcccttaatagaacattcgaggtgtaat
gctgtttatatctacaatggcatgattctgcctacaatgatctgtgctggagacctagca
gggggaattgattcctgtcagggtgacagtggaggtcctctggtgactctgcaccactct
gtgtggtggctggttggagataccagctggggcactggctgtgccactccaaacaaaccc
ggagtgtacgggaatatgactgtgtttacagactggatttataaaaatatgcaggcaaac
agatga

DBGET integrated database retrieval system