KEGG   Taeniopygia guttata (zebra finch): 100230954
Entry
100230954         CDS       T01082                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible isoform X1
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00220  Arginine biosynthesis
tgu00330  Arginine and proline metabolism
tgu01100  Metabolic pathways
tgu04020  Calcium signaling pathway
tgu04146  Peroxisome
tgu04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    100230954 (NOS2)
   00330 Arginine and proline metabolism
    100230954 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100230954 (NOS2)
   04020 Calcium signaling pathway
    100230954 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100230954 (NOS2)
Enzymes [BR:tgu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     100230954 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 DUF1400
Other DBs
NCBI-GeneID: 100230954
NCBI-ProteinID: XP_030143830
Ensembl: ENSTGUG00000008604
LinkDB
Position
19
AA seq 1156 aa
MLCPWQFVFKSRAAKSQYPQEKDINNNVEKNRKIHGSEKDDAKLHNPSKKQMERLPIITS
AKPSEGGEVCSQHHGLVNLPSNDIKLSNQVSGCPRHVRVRNLENGSSFLDTLHLTAKEVI
NCQTKACQGSLMTPKGLVRGTRDGPVPLQDLLPQAIDFLKQYYSSFKEPKIKEELGRLEA
VTKEIETTGTYHLTKDELAFAAKQAWRNAPRCIGRIQWSNLQVFDARDCKTAKEMFEHIC
HHIQYATNNGNIRSAITVFPHRTDGQHDFRVWNSQLIRYAGYQMSDGSVLGDPAAVEFTQ
LCIELGWKPKYGRFDVLPLVLQANGQDPEIFELPPEIVLQVPMEHPKYKWFKELELKWYA
LPAVANMLLEAGGLEFPACPFNGWYMGTEIGVRDFCDAQRYNILKEVGRRMGLETNKLSS
LWKDRAVVEINVAVLHSFQKQNVTIMDHHSASESFLKYMQSEYRARGGCPADWVWIVPPM
SGSITPVFHQEMLNYVLTPFYYYQVDAWKTHVWHDETRRRKKKEIKFSILAKAVLFASSL
MRGAVATRAKVTVIYATETGKSETLANSLCSLFSCAFSTKILCMDEYNICDLEKETLLLV
VTSTFGNGDSPGNGKTLKDSLLRLKLLRNKIRYAVFGLGSSMYPEFCAFAHAIDQKLAQL
GASQLTPVGEGDELNGQEEAFRSWAVSAFQAACDIFNVRGRHSIQLPKIYTSEERWDPTN
YRLVHDSQPMDLAKALANIHAKDVIPMKLKFRQNLQSLKSSRVTILVKLHCETDQEVHYL
PGEHIGIFPGNQAELVHGIIAHVKDAPPADQTIRLETCIDGGYWASHKKIPACTLPEALT
YLLDITTPPSQQLLKKLSQLVTAEGDKQRLEVLCQSTEEYNKWKFYNSPNILEVLEEFPS
AEVSAAFLLTQLPLLKPRYYSVSSSCDLTAREIHLTVAVVNYRTRDGEGPLHHGVCSTWL
NTIELNETVPCFIRSANEFHLPEEPSKPCILIGSGTGIAPFRSFWLQRLYDLEHRGLRGG
DMTLLFGCRHPDLDHIYREETEEMKRKGVLSDVYTAYSRLPGQEKVYVQDVLQGQLAARV
CEVLQGQQGHVYVCGDVRMARDVAGALRALLARALRLSQQQASEFLQQLKSQKRYHEDIF
GAVFAHEVKRALQPTS
NT seq 3471 nt   +upstreamnt  +downstreamnt
atgctgtgcccatggcagtttgtgttcaaatctcgtgctgccaagagccagtacccccag
gagaaggatatcaacaacaacgtggagaaaaataggaagatccatggctcagaaaaggat
gatgccaagttgcacaatccgagcaagaagcagatggagaggctgcctatcataacttca
gcaaagcccagtgagggaggagaggtctgttcccagcatcatggtttggtgaatctccct
tcaaatgacatcaaactttcaaaccaagtatcaggatgtccaagacatgtaagagtaaga
aacttggaaaatggatccagctttcttgacacactacacctgactgcaaaagaggttatc
aattgccagaccaaagcctgccaagggtcactcatgaccccaaagggcctggtgagaggt
accagagatgggccagttccactacaggatcttttacctcaggcaatagacttcctcaag
caatactacagttcatttaaagagccaaaaatcaaagaagagctgggccggctggaagca
gtgaccaaggagatagaaacaacaggaacttaccacctgacaaaggatgagttggccttt
gctgccaagcaggcctggaggaatgcccccaggtgcattgggagaatccagtggtccaac
ctgcaggtgtttgatgcacgagactgtaaaacagccaaggaaatgtttgagcatatctgt
catcatattcagtatgccacaaacaatggtaatataaggtcagccatcacggtgttcccg
cacaggacggacgggcagcacgatttccgtgtgtggaacagccagctgatccgctatgct
ggctaccaaatgtcagatggctctgtccttggagaccctgctgctgtggagttcactcag
ttgtgcattgaacttgggtggaagccgaaatatggccgctttgatgtacttccacttgtt
ctccaagcaaatggccaagacccagaaatatttgaattacctccagaaattgtcctccaa
gtgccaatggagcatccaaagtacaagtggtttaaggagctggagctgaagtggtacgcg
ctgcctgctgtggccaacatgcttctggaggcaggagggctggagttccccgcatgccct
ttcaatggctggtacatggggacagagatcggcgtgcgggacttctgcgacgcgcagcgc
tacaacatcctgaaggaggtagggaggagaatgggactggaaacaaataaactgtcatca
ttatggaaggaccgagctgttgtagagatcaacgtggctgtgcttcacagcttccagaaa
cagaatgtaaccatcatggatcaccactcagcctccgagtccttcctgaagtacatgcag
agcgagtaccgcgcgcggggcggctgcccggcagattgggtgtggatcgtgcctcccatg
tcaggcagcataacccctgtgttccaccaagagatgttgaactatgtcctcactcccttc
tattactaccaggtagatgcatggaaaacacatgtatggcatgatgagacccgaaggcga
aagaaaaaagaaataaagtttagcatcttggcaaaggctgtgctctttgcatcctcactg
atgcgaggggcagtggccaccagggccaaggtcaccgtgatctacgcgacagaaacgggc
aagtcggagacgctcgccaacagcctgtgcagcctgttcagctgtgccttcagcaccaag
atcctctgcatggatgagtacaatatttgtgacctggaaaaagaaacacttcttttagtg
gttactagcacttttggaaatggagattctccaggtaacggaaagaccttgaaggactct
ttgctcagactaaaactgctgagaaataaaattaggtatgctgtgtttggtctggggtcc
agcatgtacccagagttctgtgcctttgctcatgccattgaccaaaaactggcccaactc
ggggcttcccagctcactccagtgggtgaaggggatgaactcaatgggcaagaagaagct
ttccgcagctgggcagtcagtgctttccaggctgcctgtgacatctttaacgtccgtggg
agacacagtattcagttgcctaagatctacacctctgaggaaaggtgggaccctaccaat
tacaggctagtgcatgactcccagcccatggacctggctaaagctcttgcaaacattcat
gccaaggatgtaattcccatgaagctgaaatttaggcagaatcttcaaagtttgaagtcc
agtcgtgtcaccattctggttaaacttcactgtgagacagatcaggaagtgcactacctt
cccggggagcacatcgggattttcccaggcaaccaggcagaattagtccatggcattatt
gcacatgtcaaggatgcccctccagctgatcagactatcaggcttgaaacctgcattgat
ggtgggtactgggcaagtcacaaaaagattccagcctgcacactacctgaggctttgaca
tacttgcttgatatcactactccaccctcccaacaactgctaaaaaaactctcccagctg
gtgacagcagaaggagataagcaaaggctggaggtgctgtgtcagagcacagaagaatac
aataaatggaagttttacaacagcccaaacatcctggaggtgctggaggagttcccctct
gctgaggtctccgcagctttcctgctgactcagctgccacttctgaagcccaggtactat
tctgtcagctcctcctgtgacctgacagccagagagattcatctgacagttgcagttgta
aactacaggacaagagatggtgaagggcctttgcaccatggagtctgcagcacctggctg
aacacaatagagctcaacgaaactgttccctgcttcatccgcagtgctaatgagttccac
ctcccggaggagccatccaagccctgcattctgatcggctcgggcacggggattgctccc
ttcaggagcttctggctgcagcgcctctatgacctggagcacagagggctcagaggaggg
gacatgaccctgctgttcggctgccggcatccagacctggatcacatctacagggaagag
actgaggagatgaagaggaagggagtcctgagtgatgtctacacagcttactccagactg
cctggccaagagaaagtgtacgtccaggacgtgctgcaggggcagctggcggcccgcgtg
tgcgaggtgctgcaggggcagcagggccatgtgtacgtgtgcggggacgtgcgcatggcg
cgggacgtggccggggcgctgcgggcgctgctcgcccgcgccctgcgcctcagccagcag
caggccagcgagttcctgcagcagctcaagagccaaaagcgataccatgaagatatattt
ggggctgtgttcgcacatgaagtcaaaagagctttgcaacccaccagctga

DBGET integrated database retrieval system