KEGG   Taeniopygia guttata (zebra finch): 100231612
Entry
100231612         CDS       T01082                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu04068  FoxO signaling pathway
tgu04110  Cell cycle
tgu04115  p53 signaling pathway
tgu04218  Cellular senescence
tgu04310  Wnt signaling pathway
tgu04340  Hedgehog signaling pathway
tgu04371  Apelin signaling pathway
tgu04510  Focal adhesion
tgu04530  Tight junction
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100231612 (CCND1)
   04340 Hedgehog signaling pathway
    100231612 (CCND1)
   04371 Apelin signaling pathway
    100231612 (CCND1)
   04068 FoxO signaling pathway
    100231612 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100231612 (CCND1)
   04115 p53 signaling pathway
    100231612 (CCND1)
   04218 Cellular senescence
    100231612 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100231612 (CCND1)
   04530 Tight junction
    100231612 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 100231612
NCBI-ProteinID: XP_002186752
Ensembl: ENSTGUG00000005350
UniProt: H0Z4M3
LinkDB
Position
5
AA seq 292 aa
MEHQLLCCEVETIRRAYLDANLLNDRVLQTMLKAEETCSPSVSYFKCVQKEILPYMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSFEPLKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLQMELLLVNKLKWNLAAMTPHDFIEHFLTKMPLAEDTKQIIRK
HAQTFVALCATDIKFISNPPSMIAAGSVVAAVQGLHLGNTNTFLSYQCLTHFLSQVIKCD
PDCLRACQEQIESLLESSLRQAQQHNVSSETKTVEDEADLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacatcagctgctgtgctgcgaggtggagaccatccgacgagcctacctggatgcc
aacctcctcaatgacagggtgctgcagacaatgctgaaggcggaggagacctgctcgccc
tccgtctcctacttcaagtgcgtgcagaaagaaatcttgccatatatgcggaaaatagtt
gccacttggatgctggaggtttgcgaggagcagaagtgcgaagaggaagttttccccttg
gctatgaattatttggacagatttttgtcgttcgaacccctcaagaaaagccgattgcaa
ttgctcggagctacctgcatgtttgtggcttcaaaaatgaaggaaactattcctctcacc
gcagaaaaactgtgcatttatacagataactccattagacccgacgaattattgcaaatg
gagctgctgctggtgaataagctgaaatggaatctggctgcaatgaccccccacgatttc
attgaacattttcttactaaaatgcctctggcagaggacaccaagcagatcatccgtaaa
catgctcagacttttgtggctctgtgcgctacagatattaaatttatttcaaacccaccc
tccatgatcgcagctggcagcgtggtagcagctgtgcaaggcctgcatctggggaacact
aacactttcctctcctatcaatgcctcacacatttcctatcacaagttatcaaatgtgat
ccggattgtttacgagcctgccaagaacagattgagtccctcctggagtccagtctacgc
caggcacagcagcacaacgtatcttcagaaacaaagactgtagaggacgaagcagacctc
tcttgcacacctaccgatgtgcgagatgtgaacatttaa

DBGET integrated database retrieval system