KEGG   Taeniopygia guttata (zebra finch): 100231651Help
Entry
100231651         CDS       T01082                                 

Gene name
SETDB1
Definition
(RefSeq) SET domain bifurcated 1
  KO
K11421  histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100231651 (SETDB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tgu03036]
    100231651 (SETDB1)
Enzymes [BR:tgu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100231651 (SETDB1)
Chromosome and associated proteins [BR:tgu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100231651 (SETDB1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100231651 (SETDB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF5604 SET Tudor_4 TUDOR_5 Pre-SET MBD DUF4537 XkdW
Motif
Other DBs
NCBI-GeneID: 100231651
NCBI-ProteinID: XP_012426346
LinkDB All DBs
Position
25
AA seq 1214 aa AA seqDB search
MRAMDKCETLAKELYSMMGLRYRDSSSEDEAPAATEVIEIPDEEDDDVMSVDSGWRRSSS
SPRISRDQSLLREAMAAMRKSARDVAKFMDAVNKKTNLQEAQKDAQPPQESPGTAQPISV
PAAPSNDLNTDGDLKVGMRILGKKRTKTWHKGTLIAIQTVGVGKKYKVKFDNKGKSLLSG
NHIAYDYHPSAERHHVGRRVVARYKDGNQMWLYAGIVAETPNVKNKDRFLIFFDDGYASY
VKEWELYPVCRPLKKAWEDIEDVSCRDSXEEYITAYPNRPMVLLKNGQLIKTEWEGDWWK
SRVEEVDGSLVKILFLEALPMGTASVSFSFPQEDKRCEWIYRGSTRLEPMFSMKTSTAST
QEKKQSGQTRTRPNVGAVRSKGPVVQYTQDLAGTGPQYKTPEPAARPTSPQPAEMECSDT
QLAQGRKQVAKKSTSFRPGSVGSGHSSPSSPVLGDTPVAGRTLPAPQHRGPSSGPSQPFH
GMMDRVPNEPSYRAPLEKLFYLPHVCYYACLSRXRPMRSDQYRSRNPLLIPLLYDFRRMT
ARRRVNRKMGFHVLYKTPCGLCLRSMHEIERYLFETDCDFLFLEMFCLDPYVLVDRKFQP
YKPYYYIADITKGKEDVPLSCVNEIDNTPPPQVAYSKERIPGKGVYINTSWEFLVGCDCK
DGCRDKSRCACHQLTIQASGCTPGGQINPNSGYQHKRLEECLPTGVYECNKRCKCNVNMC
TNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSFVCIYAGKILTDDFADKEGLEMGDE
YFANLDHIESVENFKEGYESDAKCSSDNSGVDLKDDDDDDENTGTEELEESNEDSSDDNF
CKDENFSTSSVLRSYATRRQTRGQRDHGPSETASKDSGPARPLGHDEPATAPPCKLPVSE
EIAKNKVASWLSSNSVAEGFQDSESSSFRMGEGGEAKALKMEIPAEREKGCASTSGDLNG
ETKATKKEEPEEPTKTPGLSSLGRRYGYNPCPPRLEGIRRPVSGTVLLQSCRRSLALPPS
SENVLMVSSSTDSDEEHRAGQAPGTANDSDDIQTISSGSEEEEGEDKKNPSSGSGPVKRQ
VAVKSTRGFALKSTHGIAIKSTPLAAADKGESAGPVRRSTRQFYDGEENCYIIDAKLEGN
LGRYLNHSCTPNLFVQNVFVDTHDLRFPWVAFFASKRIRAGTELTWDYNYEVGSVEGKEL
LCCCGAIDCRGRLL
NT seq 3645 nt NT seq  +upstreamnt  +downstreamnt
atgagggccatggacaagtgcgagacgctggccaaggagctgtactccatgatgggcctg
cggtaccgggacagcagctcggaggacgaggcgccggcggccaccgaagtgatcgagatc
ccggacgaggaggacgacgacgtcatgagcgtggactcgggttggaggcgcagcagcagc
agtcccagaatctccagggatcagagtctgctgcgggaagcaatggctgccatgaggaaa
tctgcccgggatgttgcaaaattcatggatgctgtaaacaagaaaaccaacttgcaggaa
gcacagaaagatgcacaaccccctcaggaatctcctggcactgcccagcccatcagtgtc
cctgcagcccctagcaatgatctcaacactgatggggacctcaaagtgggcatgaggatt
ttggggaaaaaaagaaccaagacgtggcacaaggggacgttgattgccatccagacggtc
ggtgttggcaagaaatacaaagtgaaatttgataataaagggaagagtttgctctcgggc
aaccacattgcctacgattaccacccgtctgccgagaggcaccacgtgggcaggagggtg
gtggccaggtacaaggatggcaatcagatgtggctctatgctgggatcgtggctgagacc
cccaacgtgaagaataaagacaggttcctgatcttctttgacgacggctacgcgtcgtac
gtgaaggagtgggagctgtacccggtttgccggccactgaaaaaggcctgggaagacatt
gaggatgtttcctgtcgggattccnatgaggaatacatcactgcctatcccaaccggccc
atggtactgctgaagaatgggcagctgatcaaaactgagtgggaaggggactggtggaaa
tccagagtggaagaagtggatggaagtctggtgaaaatccttttcctggaagctcttccc
atgggaactgcaagtgtttccttctcgtttccacaagaggacaaacgttgtgagtggatt
taccgaggttccacgcgcctcgagcccatgttcagcatgaaaacttccacagcttccacc
caggaaaagaagcaaagtggacaaaccaggactcgtcccaacgttggtgctgtgaggagc
aagggccctgtggtccagtacacccaggatttagcaggaactggtccccagtacaagact
ccagagccagctgcacgtcccacatctcctcagcctgcggagatggagtgctccgacacc
cagctggcccagggcagaaagcaggtggccaagaaaagcacttccttccgtcctggctcc
gtgggctccgggcactcgtccccgtcctcccctgtcctcggggacaccccagtggccggg
aggacgctcccagccccgcagcaccgcggccccagcagcggcccctctcagcccttccac
gggatgatggaccgcgttcccaacgagccgtcttaccgcgccccgctggaaaagctgttc
tacctgccgcacgtgtgctactacgcctgcctgtcgcgnnnncggcccatgcgcagcgac
cagtaccgcagccggaacccgctgctcatcccgctgctctacgacttccgccgcatgacg
gcgcggcgccgcgtcaaccgcaagatgggcttccacgtgctctacaaaacgccctgcggg
ctctgcctgcgctccatgcacgagatcgagcgctacctcttcgagacggactgcgacttc
ctcttcctggagatgttctgcctggatccctacgtgctggtggaccgcaagttccagccc
tacaagccctactactacatcgccgacatcaccaagggcaaggaggacgtgcccctgtcg
tgcgtcaacgagatcgacaacacgccgcccccgcaggtggcctacagcaaggagcggatc
cccgggaaaggggtgtacatcaacaccagctgggagttcctcgtgggctgtgactgcaag
gacggctgcagggacaaatccaggtgtgcctgtcaccagctgaccatccaggccagcggc
tgcacccctggagggcaaatcaaccccaactcaggctaccagcacaagcggctggaggaa
tgtctcccaacaggtgtctacgagtgcaacaagaggtgcaagtgcaacgtgaacatgtgc
accaaccgcctggtccagcacggcctccaggtgcggctgcagctcttcaagacccagaac
aaaggttggggcattcgctgcctcgacgacatcgccaagggctcctttgtctgcatctac
gcagggaaaatcctcacggacgactttgctgacaaagaggggctggagatgggtgacgag
tactttgccaacctggaccacatcgagagcgtggagaacttcaaggagggctacgagagc
gacgccaagtgctcctcggacaacagcggcgtggacctcaaggacgacgacgacgacgac
gagaacacgggcacggaggagctggaggaatccaacgaggacagctccgacgacaacttc
tgcaaggacgagaacttcagcacgagctcggtgctgcgcagctacgccacgcgccggcag
acgcgcggccagcgcgaccacggcccgtccgagacggcctccaaggactcggggccagcg
cggcccctcggccacgacgagcccgccacggccccgccctgcaagctgcccgtgtccgag
gagatcgccaagaacaaagtggcctcgtggctgagctccaacagcgtggccgagggcttc
caggacagcgaatcctcctccttcaggatgggcgaaggaggagaagccaaggctctgaag
atggagatccctgcagagagggagaagggctgtgcttccacgtcgggagatctgaacgga
gagacaaaggcaaccaagaaggaggaacctgaagaaccaaccaaaactcctgggctgagc
agcttgggaaggaggtatggctacaacccctgcccgcccaggctggagggcatccgcagg
ccggtgagtgggacggtgctgctgcagagctgccggcggtccctggccctgccgccctcc
tcggagaatgtgctgatggtgtcgagcagcaccgacagcgacgaggagcacagggcaggg
caggccccgggcacagccaacgacagcgacgacatccagaccatttcctcaggatccgag
gaggaggaaggggaggacaagaagaatccatcatctgggtcaggtcccgtgaagagacag
gtggctgtgaaatccacccgaggcttcgccctcaagtccacccacggcatcgccatcaaa
tccacgccgctggcggcggccgacaagggcgagagcgcggggcccgtgcgccgcagcacg
cggcagttctacgacggggaggagaactgctacatcatcgacgccaagctcgagggcaac
ctgggccgctacctcaaccacagctgcaccccaaacctcttcgtgcagaacgtcttcgtg
gacacccatgaccttcgcttcccctgggtcgccttcttcgccagcaagcggatccgagcg
ggcacggagctgacctgggattacaactacgaggtcggcagcgtggagggcaaggagctg
ctgtgctgctgcggggccatcgactgccggggccggctgctctga

DBGET integrated database retrieval system