KEGG   Taeniopygia guttata (zebra finch): 100231762Help
Entry
100231762         CDS       T01082                                 

Gene name
THPO
Definition
(RefSeq) thrombopoietin
  KO
K06854  thrombopoietin
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100231762 (THPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:tgu04052]
    100231762 (THPO)
Cytokines and growth factors [BR:tgu04052]
 Cytokines
  CSF and other factors
   100231762 (THPO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EPO_TPO
Motif
Other DBs
NCBI-GeneID: 100231762
NCBI-ProteinID: XP_002192286
Ensembl: ENSTGUG00000010381
LinkDB All DBs
Position
9
AA seq 200 aa AA seqDB search
MQGRSPQPSMELNRLLLLTSFLLHVKEDRASPTRLVCDNRLIQKYIVEAKDMEKRVGQCQ
ALPALRCPAVLPLVDFTFLQWKAKSNETKRREILCDLALLVGAAAGAQGQVSDECGARQL
SQLYRHANSFFLLLQSFSWEAGHWEPSCSPHSTEQTHISSIFLTYRQLVQGKLRFFFSDL
AKVLCKQGQGDSRDPPCGAR
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgcagggccggagcccccagccgagcatggagctgaacagactgctcctcctcacatcc
ttcctcctgcacgtgaaagaggaccgtgccagcccaacgcggctggtctgtgacaacagg
cttatccagaagtacatcgtggaggccaaggacatggaaaagagagtgggccagtgccag
gccctgcctgcactcaggtgccctgcagtgctgcccttggtggacttcactttcctgcag
tggaaagccaaatcgaacgagaccaagcggcgggagatcctgtgtgacctggccctgctg
gtgggtgctgcagcaggggcccagggccaggtgagcgacgagtgcggggccaggcagctg
agccagctttaccgacacgccaactccttcttcctgctcctgcagagcttcagctgggag
gcaggacactgggagccgagctgctccccacactccacggagcagacccacatctccagc
attttcctcacctaccggcagctggtacagggcaagctgcgcttcttcttctctgacctg
gccaaggtcttgtgcaagcaaggacagggggacagcagagaccctccatgcggggcccgg
tga

DBGET integrated database retrieval system