KEGG   Taeniopygia guttata (zebra finch): 100232653Help
Entry
100232653         CDS       T01082                                 

Gene name
GYS2
Definition
(RefSeq) glycogen synthase 2
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00500  Starch and sucrose metabolism
tgu01100  Metabolic pathways
tgu04910  Insulin signaling pathway
Module
tgu_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100232653 (GYS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100232653 (GYS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:tgu01003]
    100232653 (GYS2)
Enzymes [BR:tgu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     100232653 (GYS2)
Glycosyltransferases [BR:tgu01003]
 Polysaccharide
  Storage polysaccharide
   100232653 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_5 Glyco_transf_4 Glycos_transf_1 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 100232653
NCBI-ProteinID: XP_002193458
Ensembl: ENSTGUG00000012106
UniProt: H0ZPF0
LinkDB All DBs
Position
1A
AA seq 704 aa AA seqDB search
MPLARSLSMTSLNGLLQCEDEDLPVEDLLLFEISWEVTNKVGGIYTVIQTKAKTTADEWG
ENYFLIGPYFEQNVKTQVEFSEPPNPAVKKAMDAMKSQGCQVFFGRWLIEGSPYVLLFDI
GSAAWNLDKWKGGFWEVSNIGIPFHDREANDAVIFGSLTAWFLKELSCQFDDKPNIIAHF
HEWQAGVGLILSRSQKLPVATIFTTHATLLGRYLCAASIDFYNNLDQFDIDKEAGERQIY
HRYCMERASVHCAHVFTTVSQITATEAEHMLKKCPDVVTPNGLNIKKFSAMHEFQNLHSM
YKARIQEFIRGHFYGHLDFDLDKTLFFFIAGRYEFSNKGADMFLEALSRLNFLLRVHKTD
VTVIVFFIMPAKTNNFNVETLKGQAVRKQLWDTAQSVKEKFGRKLYNALLKGEIPDLNKI
LDRDDISIMKRAIFSTQRHSLPPVTTHNMIDDSNDPILNTIRRIGLFNNRTDRVKVILHP
EFLSSTSPLLPLDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQ
EHVADPEAYGIYIVDRRFRSPDESCNQLTQFLYGFCQQNRRQRIIQRNRTERLSDLLDWK
YLGRYYMHARHLALSRTFPDKFEMEPSAPPKTEGFRYPRPSSVPPSPSASQHSSPHHSEA
EDDDEDERYDEDEEAERDRQNIKSPFSLGALPQGKKKQHGEYRN
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgccactggcaagatccctgtccatgacatctctgaatgggcttcttcagtgtgaggat
gaagacctgcccgtggaggatttgttgctctttgaaatttcttgggaagttaccaacaaa
gtgggaggcatttacactgtgatccagacaaaagccaaaactacagcagatgaatgggga
gaaaattatttcctcattggcccctattttgagcagaatgtgaaaactcaggtggaattc
tctgaacctccaaaccctgcagttaagaaggcaatggacgccatgaaaagccaagggtgt
caggtcttttttggaagatggctgatagagggcagcccatatgtcttactctttgatata
ggatcagcagcttggaacctggacaagtggaaaggtggattttgggaggtcagcaacata
gggataccttttcatgaccgagaagccaacgatgctgtgatttttggatcattaacagcc
tggtttttgaaagagctttcctgtcagtttgatgacaagcccaatataattgcccacttc
cacgagtggcaggcaggagtgggtttaatcctgtctcgatcacagaaacttcctgttgcc
acaatttttactacccatgcaactctgcttgggagatacttgtgtgcagccagtattgac
ttttacaacaatctggaccagtttgacattgacaaggaggctggagagaggcagatttac
catcggtactgtatggaacgggcatctgtgcattgtgcccatgtgttcaccacagtctcc
cagatcacagctacagaagcagaacatatgcttaaaaaatgccctgatgttgtcacccca
aatggcttgaacattaagaaattttcagcaatgcatgagtttcagaatttgcattccatg
tacaaggctaggatccaagagttcattcgaggtcatttctatggccaccttgacttcgat
cttgacaagactttgtttttcttcattgctgggagatatgagttttccaacaaaggagct
gatatgtttctagaagccttatcaagattaaactttttgctgagggttcacaagactgac
gttacagttattgtgttcttcatcatgccagcaaagaccaacaatttcaacgtggaaacc
ttgaaaggacaagcagtccggaagcagctctgggacactgcacaatctgtgaaagaaaag
tttggaaggaaactctacaatgccttgctgaaaggagaaatcccagacttgaacaagatt
cttgaccgagatgacataagcattatgaaaagagccatcttttcaactcagagacactct
ctgcctccagtgaccacccacaacatgattgatgacagcaacgacccaatcctcaacacc
atccggcgcattgggctgttcaataaccgcacagaccgcgtgaaggtcatcctacatcca
gagtttctttcttcaacaagtcccttgctgcccctggactatgaggagtttgttagaggc
tgccaccttggtgtattcccatcttactatgaaccctggggctacactccagctgagtgt
actgtgatgggcattcccagtgtaaccacaaacctctctggattcggctgtttcatgcag
gaacatgttgctgacccagaagcttatgggatctacatcgtggacaggaggttccgctcg
ccggacgagtcgtgcaaccagctgacccagttcctgtacgggttctgccagcagaaccgg
cgccagaggatcatccagaggaaccgcaccgagcgcctctccgacctcctggactggaag
tacctgggcaggtattacatgcatgccagacacttggccctcagcagaacattcccagat
aaatttgagatggaaccaagtgctccaccaaagacagaaggtttcaggtaccccaggcct
tcatcggtgccgccgtcgccctcggcctcccagcattccagccctcaccacagcgaagcc
gaggacgacgatgaggatgagagatatgatgaggatgaggaggctgaaagggacaggcag
aacatcaagtcccccttttcccttggagccttgcctcaaggaaaaaagaagcagcacggg
gaatacaggaactga

DBGET integrated database retrieval system