KEGG   Taeniopygia guttata (zebra finch): 100232670Help
Entry
100232670         CDS       T01082                                 

Gene name
MICAL1
Definition
(RefSeq) microtubule associated monooxygenase, calponin and LIM domain containing 1
  KO
K19947  F-actin monooxygenase [EC:1.14.13.225]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tgu04131]
    100232670 (MICAL1)
Enzymes [BR:tgu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.225  F-actin monooxygenase
     100232670 (MICAL1)
Membrane trafficking [BR:tgu04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    100232670 (MICAL1)
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    100232670 (MICAL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3585 CH CAMSAP_CH FAD_binding_3 LIM FAD_binding_2 Pyr_redox_2 Pyr_redox_3 NAD_binding_8 HI0933_like DUF4778 GIDA DAO Pyr_redox FAD_oxidored Thi4 Lycopene_cycl NAD_binding_7 AlaDh_PNT_C ThiF
Motif
Other DBs
NCBI-GeneID: 100232670
NCBI-ProteinID: XP_012426429
LinkDB All DBs
Position
26
AA seq 952 aa AA seqDB search
MSVPADEPGNPAHAIFERFLRAGECREVLGCFVELCQQLGLQGSGLQLYHGLKAALNYWN
AKALWSKLDKKAGHKDYEQGTACAGTKCLVVGAGPCGLRAAIELALLGARVVLLEKRDSF
SRNNVLHLWPFTIHDLRALGAKKFYGRFCTGTLDHISIRQLQLILLKVALLLGVEVHINV
RFEGLVPPTGKAGGWQAVLQPSSSPLTHYEFDVLISAGGGKFVPEGFKRKETRGKLAIGI
TTNFINRHSRAEVEVAEISGVARIYNQKFFQNLYNRTGIDLENIVYYKDDTHYFVMTAKK
QSLLKKGVILQDKADIESLLAPENVNRDALLSYAKEAANFSTNYCLPQLEFALNHRGLPD
VDMFDFTCMTRSENAALVREHNGSRVLLGLVGDCLVEPFWPLGTGVARGFLAAFDAAWMV
RRWAAGTPPLEVLAERESIYQRLSQTSPDNTNKNISQYSIDPATRYPNINLQAIKASQVR
DLYLVGTVEVDHKRKSDNRLSTVAPGAVSEELLSWCQASTAGYPGVAVTNFSTSWTSGLA
LCALIHRFRPDLVDFDSVEPQDALRTHQMLLDIAEQELGIQPVLSSAEMATMTEPDCLGL
ITYLSHFYQIFGTSPEVEVSKKPLSPRGTRGAILFLSKLQKSRTLAHKRTQDGAQKDSEV
KRSRGDTELDTGLDGDTQDSAHELPQPTVMDPGQPPRERAGDNSDACYFCGRRVYIVERA
SAEGRFFHRGCFQCRRCAATLRLGDYAFDEEDDLEDSDSEEEEEKEEEEDTGLGIMKELY
PDPREEEKYPTWKRTLARRARESQMKRFCRAQAIQRRLEEIEVTFRELEQQGIKLEKLLR
DENESPADQQTQWTNQLLYLVQKKNNLMTEESDLMIAVQELKLEEQQCQLDKKLRSYMNK
EDALKTPEDEKAEQEILKQLVEVVNKRNVLIQLQEEKRLSELLLGTGSRGPL
NT seq 2859 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgccagccgacgagccgggcaacccggcccatgccatcttcgagaggttcctg
cgtgccggggagtgccgggaggtgctgggctgcttcgtggagctgtgccagcagctgggg
ctgcagggcagtgggctgcagctctaccacggcctcaaggctgccctcaactactggaat
gccaaggccctgtggagcaagctggataagaaagctgggcacaaggactacgagcagggc
acagcctgtgctggcaccaagtgcctggtggtgggtgctggcccctgcgggctgcgggcg
gccatcgagctggcactgctgggtgcccgcgtggtgctgctggagaaacgcgactccttc
tcccgcaacaacgtcctgcacctctggcccttcaccatccacgacctgcgggcgctgggc
gccaagaagttctacgggcgcttctgcacgggcacgctggaccacatcagtatccggcag
ctccagctgatcctgctgaaggtggctttgctcctgggggtggaggtgcacatcaatgtg
cggttcgagggccttgttccccccacgggcaaggcaggtggttggcaggctgtgctgcag
cccagctcctctcccctcacccactacgagtttgatgtcctcatctcagctggcggtggc
aaatttgtccctgaagggttcaagcggaaggagacgcgtgggaagttggccattggcatc
accaccaacttcatcaaccgccacagccgggccgaggtggaggtggccgagatcagcggc
gtggcccgaatctacaaccagaagttcttccagaacctctacaacagaacgggcattgac
ctggaaaacatcgtgtactacaaggatgacactcactatttcgtcatgacggccaagaag
cagagcctgctcaagaagggggtcatcctccaggacaaagcggacatcgagagcctcctg
gccccagagaatgtgaaccgggatgccctccttagctatgccaaagaagctgccaacttc
tccaccaactactgcctgccccagctggagtttgccctcaaccaccggggcctgccggat
gttgacatgttcgacttcacctgcatgacgcgctcggagaacgcggcgctggtgcgggag
cacaacgggagccgtgtgctcctggggctggtgggcgactgcttggtggagcccttctgg
ccgctgggcaccggcgtggccaggggtttcctggccgcctttgacgcggcgtggatggtg
cggcgctgggcagccgggacacccccgctggaggtgctggccgagagggagagcatctac
cagcgcctttcgcagacatccccagacaacaccaacaagaacatcagccagtacagcatc
gacccggccacgcgctaccccaacatcaacctgcaggccatcaaagccagccaggtcagg
gacctctacctcgtgggcacggtggaggtggaccacaagaggaagagtgacaaccggctc
agcaccgtggcccctggagctgtctctgaagagctgctgagctggtgccaggccagcaca
gctggataccctggcgtggccgtcaccaacttcagcacctcctggaccagtggtttggcc
ctttgcgccctcatccaccgcttccgccccgacctggtggactttgactctgtggagccc
caggatgcccttcggacccaccagatgttgctggacatagcagagcaggagctgggcatc
cagcccgtcctctccagtgctgagatggccaccatgacagagcctgactgcctgggcctc
atcacctacctcagccacttctatcaaatttttgggacctctccagaggtggaggtcagc
aagaagccgctgtctccccgaggcacacgaggggccatcctcttcctcagcaagctgcag
aagagccggaccctggcacacaaacgtacccaggacggtgcccagaaggacagtgaggtc
aagaggagccgcggggacaccgagctggacacggggctggatggagacactcaggacagt
gcccacgagctgccacaacccaccgtgatggacccagggcagccaccgagggagagggca
ggggacaacagtgacgcctgctacttctgtgggcgccgtgtctacatcgtggagcgagcc
agcgccgagggacgcttcttccaccgcggctgcttccagtgccggcgctgcgcggccacc
ctgcgcctgggcgactatgccttcgacgaggaggatgacttggaggacagtgacagcgag
gaggaggaggagaaagaggaggaggaggacacaggccttggcatcatgaaagagctgtac
ccagaccccagggaagaggagaaataccccacctggaagcgcacgttggcccgccgggcc
agggaatcgcagatgaagaggttctgcagagcccaggccatccagaggcggctggaggag
atcgaggtgacattccgggaactggagcagcagggcatcaagctggagaagttactccgg
gatgagaatgagagcccggctgaccagcagacacagtggacaaaccagctgctctacctg
gtccagaagaagaacaacctgatgaccgaggagtcggacctcatgatcgcggtgcaggag
ctgaagctggaggagcagcagtgtcagctggacaagaagctccggagctacatgaacaag
gaggatgccctgaagacacccgaggatgagaaggctgagcaggagatcctgaagcagctg
gtggaggtggtgaataagcggaacgtcctcatccagttgcaggaggagaagcggctcagt
gagctcctgctggggacagggtcacggggccctttgtga

DBGET integrated database retrieval system