KEGG   Taeniopygia guttata (zebra finch): 105759380
Entry
105759380         CDS       T01082                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu04012  ErbB signaling pathway
tgu04068  FoxO signaling pathway
tgu04110  Cell cycle
tgu04115  p53 signaling pathway
tgu04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    105759380 (CDKN1A)
   04068 FoxO signaling pathway
    105759380 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    105759380 (CDKN1A)
   04115 p53 signaling pathway
    105759380 (CDKN1A)
   04218 Cellular senescence
    105759380 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 105759380
NCBI-ProteinID: XP_030147844
LinkDB
Position
26
AA seq 151 aa
MPLSQSRAGQSLCGSKACRNLFGPVDHEQLQRDFEDKIKQELEEAQQRWNFNFETETPLE
GPFKWERILVPEQPPQEVHSLVRAVISGDSRSSLAHRVPPKDRVGRICPEEAQQSSKVCK
AGSLQSLKRGQTTIKDFYSAKRRIVPARPQP
NT seq 456 nt   +upstreamnt  +downstreamnt
atgccgctgtcccagagcagggctgggcagagcctgtgcggcagcaaggcctgcaggaac
ctcttcggccccgtggaccacgagcagctccagcgtgactttgaggacaagataaaacaa
gagctggaagaagctcagcagcgctggaacttcaactttgagacagagactcccttggaa
gggccgttcaagtgggagaggatcctggtgcctgagcagccgccccaggaggttcacagc
ctggtcagggctgtcatcagcggtgacagcaggagctccttggcccacagggtccccccc
aaggaccgtgttggcaggatttgccctgaggaggctcagcagagctcgaaggtttgcaag
gctggttccctgcagagcctgaaacgtgggcagaccacgatcaaagacttctacagtgcc
aagaggaggatcgtccctgcccggccccagccgtga

DBGET integrated database retrieval system