KEGG   Taeniopygia guttata (zebra finch): 115491626
Entry
115491626         CDS       T01082                                 

Gene name
LPAR2
Definition
(RefSeq) lysophosphatidic acid receptor 2
  KO
K04291  lysophosphatidic acid receptor 2
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu04080  Neuroactive ligand-receptor interaction
tgu04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    115491626 (LPAR2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    115491626 (LPAR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:tgu04030]
    115491626 (LPAR2)
G protein-coupled receptors [BR:tgu04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    115491626 (LPAR2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srt Glycophorin_A
Other DBs
NCBI-GeneID: 115491626
NCBI-ProteinID: XP_032601542
LinkDB
Position
Unknown
AA seq 337 aa
MRHCFYNESVGFFYNNSRKELSATWRPRDALLLALGLALGAAVLLANLLVIAAVATNRRF
HHPIYYLLANLAAADLFAGVAYMFLMFHTGPRTAQLSLKTWFVRQSLLDTSLTASVVNLL
AIAVERHRTVLSVQLHSEMSAQRVVGLIFSIWAAALLLGLIPSYGWHCLCSLESCSRMAP
LYSRSYLTFWAISNLVVFLVMVMVYGHIFVYVRRRMARMARHTGAHPRHRDTVLALVKTV
TIVLGAFVVCWTPGQVVLLLDGLGCQSCDVLAVEKYVLLLAEINSLINAIVYSWRDNEMR
NTFRRILCFPCLRNSKYAAPERGLSSHNGHFTVDSSI
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgcggcactgcttctacaacgagtccgtcggcttcttctacaacaacagccgcaaggag
ctgagcgcgacatggcggcccagggacgcgctgctgctggcgctgggcctggcgctcggc
gccgcggtgctgctggccaacctgctggtcatcgccgccgtggccaccaaccgccgcttc
caccaccccatctactacctgctggccaacctcgccgccgccgacctcttcgccggcgtg
gcctacatgttcttgatgttccacaccgggcctagaaccgcccagttgtcgctcaagact
tggttcgtccggcagagcttgttggacaccagtttgacggcttcggtggtcaacctgttg
gccatcgcggtggagcggcaccggacggtgctgagcgtgcagctgcacagcgagatgtcc
gcccagcgcgtggtggggttgatcttctccatctgggcggcggcgctgctgctgggcttg
atcccgtcctacgggtggcactgcctgtgctccttggagagctgctccaggatggcgccg
ctctacagccgcagctacttgaccttctgggccatctccaacctggtggtgttcctggtc
atggtgatggtctacgggcacatcttcgtctacgtcaggaggaggatggcgcgcatggcg
cggcacacgggcgcccacccgcggcaccgcgacaccgtgctggcgctggtcaagaccgtc
accatcgtcctgggtgccttcgtggtgtgctggaccccgggccaggtggttctgctgctg
gacgggctgggctgccagagctgcgacgttctggccgtggagaagtacgtgctgctgctg
gccgaaattaactccctcattaacgccatcgtttactcgtggcgcgataacgagatgagg
aacaccttccgacggatcctgtgcttcccgtgcctccggaattccaaatacgccgctccg
gaacgggggctgagctcccacaacggccacttcaccgtcgattcttccatttag

DBGET integrated database retrieval system