KEGG   Taeniopygia guttata (zebra finch): 115491960
Entry
115491960         CDS       T01082                                 

Gene name
IKBKG
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu04010  MAPK signaling pathway
tgu04210  Apoptosis
tgu04620  Toll-like receptor signaling pathway
tgu04621  NOD-like receptor signaling pathway
tgu04622  RIG-I-like receptor signaling pathway
tgu04623  Cytosolic DNA-sensing pathway
tgu04625  C-type lectin receptor signaling pathway
tgu04920  Adipocytokine signaling pathway
tgu05132  Salmonella infection
tgu05164  Influenza A
tgu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    115491960 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    115491960 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    115491960 (IKBKG)
   04621 NOD-like receptor signaling pathway
    115491960 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    115491960 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    115491960 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    115491960 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    115491960 (IKBKG)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    115491960 (IKBKG)
  09172 Infectious disease: viral
   05164 Influenza A
    115491960 (IKBKG)
   05168 Herpes simplex virus 1 infection
    115491960 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tgu01001]
    115491960 (IKBKG)
Protein kinases [BR:tgu01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   115491960 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ zf_C2H2_10 NEMO FliT
Other DBs
NCBI-GeneID: 115491960
NCBI-ProteinID: XP_032601643
LinkDB
Position
Unknown
AA seq 537 aa
MSGGRWRRPAEMVQPGPEAEPALAEALQRLRAENRELRGALCHCTQSLRQRLEELRKLQQ
QRRGERELLWGRWGQARELVLHLRGQRGDSPGDSPEDTPDTAGDSRDTPGDTAGGIRDIQ
DTPGDNRDTPENTKDTPGDTKDTPGDTKDTPGDIRDILTDTKDTAGDIRDTLRDTLRDTG
DICRTSPDTSTEPPEAPPRSVSPVPFEDVPAVPEPPQAPPGAPPEPSSEEQLRQRLAEAE
AELVALRTRVAVAELRAQDVSRAAELQLQSLRRQLEQDKAQVQAQVTSLLGELRESQNRL
ERSRAEREHLERRARGDAERCHQLEEVAQGHQVQLDQLRLQVTNLETALRVERHGATEEK
RKLVQLQAAYHHLFQEYDAHIKASLEGDKRSQVTQEQLRAAEAALALKQELIDRLKAEAE
RQRAALETIPVLQAQADIYRADFEAERAAREQLHGQREALQEELKQLRLRLSGDGARARL
EEMRNRHSEPPPAPAPAGGFGGLLPPPEEGPDLCCPKCQYKAPDMDTLQIHVMDCIK
NT seq 1614 nt   +upstreamnt  +downstreamnt
atgagcggcgggcgctggcggcggcccgcagagatggtgcagcccgggcccgaggcggag
ccggcgctggcggaggcgctgcagcggctgagggcggagaaccgcgagctgaggggtgcc
ctgtgtcactgcacgcagtcgctgcggcagcgcctggaggagctgcggaagctgcagcag
cagcgtcggggcgagcgggagctgctctggggacgttggggacaggcccgggagctggtg
ctgcacctgcggggacagcgcggggacagccctggggacagccctgaggacaccccggac
accgctggggacagcagggacacccccggggacaccgctggaggcatcagggacatccag
gacactcctggggacaacagggacacccccgagaacaccaaggacacccctggggacacc
aaggacacccctggggacaccaaggacacccctggggacatcagggacatcctcacggac
accaaggacaccgctggggacatcagggacaccctcagggacacgctcagggacactggg
gacatctgcaggaccagccctgacaccagcactgagccccccgaggcgccgccccgctcg
gtgtcccctgtccccttcgaggacgtccccgctgtcccggagcccccccaggcccccccc
ggggcccccccggagcccagctccgaggagcagctgaggcagcgcctggcggaggccgag
gctgagctggtggcactgaggacacgcgtggccgtggcagagctccgggctcaggacgtt
tcccgcgcggccgaactgcagctgcagagcctgaggcgccagctggagcaggacaaggcc
caggtccaggctcaggtgacgtcgctcctgggggagctccgggagagccaaaatcgcctg
gagaggagccgggcggagagagaacacctggagcgcagggcccgcggggacgccgagcgc
tgccaccagctggaggaggtggcccagggccaccaggtgcagctggaccagctgcggctc
caggtgaccaacctggaaaccgccctgagggtggagcggcacggggccaccgaggagaag
aggaagctggtgcagctgcaggccgcctaccatcacctgttccaggagtacgatgcccac
atcaaggccagcctggagggggacaaacggagccaggtgacgcaggagcagctgcgcgcg
gccgaggcggcgctggccctcaaacaggagctcatcgaccgcctcaaggccgaggccgag
cggcagcgggcggcgctggagaccatccccgtgctgcaggcccaggccgacatttaccgg
gcggatttcgaggcggagcgcgcagcgcgggagcagctgcacgggcagagggaggcgctg
caggaggagctgaaacagctgcggctgcggctgagcggggacggggcccgggcccgactg
gaggagatgcggaaccgtcactcggagccgcccccggccccggccccggcggggggtttt
ggggggctcctgccgccccccgaggaggggccggacctgtgctgccccaagtgtcagtac
aaggccccggacatggacacgctgcagatccacgtcatggactgcatcaagtga

DBGET integrated database retrieval system