KEGG   Taeniopygia guttata (zebra finch): 115492066
Entry
115492066         CDS       T01082                                 

Gene name
RELA
Definition
(RefSeq) transcription factor p65 isoform X1
  KO
K04735  transcription factor p65
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu04010  MAPK signaling pathway
tgu04137  Mitophagy - animal
tgu04210  Apoptosis
tgu04218  Cellular senescence
tgu04620  Toll-like receptor signaling pathway
tgu04621  NOD-like receptor signaling pathway
tgu04622  RIG-I-like receptor signaling pathway
tgu04623  Cytosolic DNA-sensing pathway
tgu04625  C-type lectin receptor signaling pathway
tgu04920  Adipocytokine signaling pathway
tgu05132  Salmonella infection
tgu05164  Influenza A
tgu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    115492066 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    115492066 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    115492066 (RELA)
   04218 Cellular senescence
    115492066 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    115492066 (RELA)
   04621 NOD-like receptor signaling pathway
    115492066 (RELA)
   04622 RIG-I-like receptor signaling pathway
    115492066 (RELA)
   04623 Cytosolic DNA-sensing pathway
    115492066 (RELA)
   04625 C-type lectin receptor signaling pathway
    115492066 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    115492066 (RELA)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    115492066 (RELA)
  09172 Infectious disease: viral
   05164 Influenza A
    115492066 (RELA)
   05168 Herpes simplex virus 1 infection
    115492066 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tgu03000]
    115492066 (RELA)
Transcription factors [BR:tgu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    115492066 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 115492066
NCBI-ProteinID: XP_032601578
LinkDB
Position
Unknown
AA seq 492 aa
MRFRYKCEGRSAGSIPGEHSSESTRTHPTIRVNNYRGPGRVRVSLVTKDPPHRPHPHELV
GKDCRDGFYEAELCPERSVHSFQNLGIQCVKKRELEAAVAERIRTNNNPFNVPAEQRGGE
YDLAAVRLCFQVWVRGPGGLQPLPPVLSQPIYDNRAPSTAELRICRVNRNSGSCRGGDEI
FLLCDKVQKEDIEVRFSAEGWEAKGSFAQADVHRQVAIVFRTPPFRDPALRVPVTVRMEL
QRPSDRQRSAPLDFRYLPHQGDLQCIEEKRKRTRETFRSFIQRSPLPAPASSEARPPRRI
AVPSRPPPAPQNPPSAAPSFSFGGPGGLLGGPAPPEAEPLAEALLQLQFEEGSPQIVEGG
GAAPPLDFGALLGGGDSPFPALDAINASEVQRLLGPPEPPPSFGDPSPDFGGGVSVLPPP
PPDFGGPPMLMSYPEAIARLVQSQPPGAPPEMGLGAELGGGPELGGLGGPEESLPSLGEL
DFSTFLSQFPSS
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgagattccgctacaagtgcgaggggcgctcggccgggagcatccccggggagcacagc
agcgagagcaccaggacccaccccaccatccgcgtgaacaactaccggggcccggggcgc
gtgcgggtgtcactggtgaccaaagaccccccgcaccgcccgcacccccacgagctggtg
ggcaaagactgccgggacggcttctacgaggccgagctgtgccccgagcgcagcgtgcac
agtttccagaatttggggattcagtgcgtgaagaagcgggagctggaggcggccgtggct
gagcggatccgcaccaacaacaaccccttcaacgtgccggcggagcagcgcgggggcgag
tacgacctggccgcggtcaggctctgcttccaggtgtgggtgaggggcccgggggggctg
cagcccctgccccccgtcctgtcccagcccatctacgacaaccgtgcccccagcacggcc
gagctccggatctgccgcgtcaaccgcaactccgggagctgccggggcggggacgagatc
ttcctgctgtgtgacaaggtccagaaagaggacatcgaggtgcgtttctcggccgagggt
tgggaggccaagggctccttcgcgcaggccgacgttcaccgccaggtcgccatcgtgttc
cgcacgccgcccttccgggacccggcgctgcgcgtccccgtcaccgtgcgcatggagctg
cagcggccctcggaccgccagcgcagcgccccgctggacttccgctacctgccccaccag
ggggacctgcagtgcatcgaggagaagcgcaagcggacgcgggaaaccttccgctccttc
atccagcgcagccccctgcccgctccggcgtccagcgaggcgcggcccccccggcgcatc
gcggtgccctcgagaccccccccggccccccagaacccccccagtgcggctccctccttc
tctttcgggggtcccggggggctcctggggggcccggccccccccgaggcggagcctttg
gccgaggcgctgctgcagctgcaatttgaggaggggtccccccaaatcgtggagggcggc
ggcgcggcccccccgctggatttcggggcgcttttgggtgggggggactcccccttcccc
gccctggacgccatcaacgcctccgaggtccagcgcctgctgggcccccccgagcccccc
cccagctttggggacccctccccggattttggggggggggtttccgtgctgcccccgccc
cccccggattttgggggcccccccatgctgatgtcgtaccccgaggccatcgcccgcctg
gtgcagagccaacccccgggggcgccccccgaaatggggctgggggccgagctgggcggg
ggtcccgagctgggggggctgggggggcccgaggagtcgctgccctcgctgggggagttg
gacttcagcaccttcctcagccagttcccctcctcctga

DBGET integrated database retrieval system