KEGG   Taeniopygia guttata (zebra finch): 115492646
Entry
115492646         CDS       T01082                                 

Gene name
EPO
Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    115492646 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:tgu04052]
    115492646 (EPO)
Cytokines and growth factors [BR:tgu04052]
 Cytokines
  CSF and other factors
   115492646 (EPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 115492646
NCBI-ProteinID: XP_032601268
LinkDB
Position
Unknown
AA seq 187 aa
MGAAGLCAALLLLLLGVPGRPQPPPETPPSLCDPRVIERFILEAREAERGAAGCGPPCDL
PEPVAVPDPGVNFNFWRSLDARSRAREVAAGQAALAAAVLRAREQLRDPRVRPSLDRAHG
AARSLARLLRGLAAPAPPTPLPPPGPVRVRNVPRLLGVLSRFLRGKVRLFLTDSCQSSPL
RAVNHHR
NT seq 564 nt   +upstreamnt  +downstreamnt
atgggggcggcggggctgtgcgcggcgctgctgctgctgctgttgggggtcccggggcgc
ccccagcccccccccgagacccccccctcgctctgcgacccccgagtgatcgaacggttc
atcctggaggcgcgggaggccgagcggggggcggccgggtgtggccccccctgtgacctc
cccgagcccgtggctgtccccgaccccggagtcaacttcaacttctggcggagcctcgac
gcgcggtcccgggcgcgggaggtggccgcgggtcaggcggcgctggcggccgcggtgctg
cgggcgcgggagcagctccgggacccgcgggtgcgcccgagcctggaccgagcgcacgga
gcggcgcggagcctggcgcggctgctgcgggggctggcggcgccggccccgcccacgccc
ctccccccccccggcccggtgcgggtccggaacgttccgcggcttttgggggtcctgagc
cgcttcctgcgggggaaggtgcggctgttcctgactgacagctgtcaatcatcaccattg
agagctgtcaatcatcaccgctga

DBGET integrated database retrieval system