Taeniopygia guttata (zebra finch): 115493336 Help Entry 115493336         CDS       T01082                                  Name (RefSeq) histone H2A type 2-C   KO K11251   histone H2A Organism tgu  Taeniopygia guttata (zebra finch) Pathway tgu03082   ATP-dependent chromatin remodeling tgu04217   Necroptosis Brite KEGG Orthology (KO) [BR:tgu00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     115493336  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     115493336  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tgu03036]     115493336   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tgu04147]     115493336 Chromosome and associated proteins [BR:tgu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     115493336 Exosome [BR:tgu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    115493336 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Ribosomal_L27A Motif Other DBs NCBI-GeneID:  115493336 NCBI-ProteinID:  XP_030118697 LinkDB All DBs Position 1A:45916183..45916755 Genome browser AA seq 129 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESHKAKSK NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgtccgggcgggggaagcagggcggcaaggcgcgcgccaaggccaagtcgcgctcgtcg cgggccgggctgcagttccccgtgggccgcgtgcaccggctgctgcgcaagggcaactac gcggagcgcgtgggcgccggcgcgccggtgtacctggcggccgtgctggagtacctgacg gccgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacgcgcatcatc ccccgccacctgcagctcgccatccgcaacgacgaggagctcaacaagctgctgggcaag gtgacgatcgcgcagggcggcgtgctgcccaacatccaggccgtgctgctgcccaagaag actgagagccacaaagccaagagcaagtaa

DBGET integrated database retrieval system