KEGG   Taeniopygia guttata (zebra finch): 778442Help
Entry
778442            CDS       T01082                                 

Gene name
GAD1, GAD67
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00250  Alanine, aspartate and glutamate metabolism
tgu00410  beta-Alanine metabolism
tgu00430  Taurine and hypotaurine metabolism
tgu00650  Butanoate metabolism
tgu01100  Metabolic pathways
Module
tgu_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    778442 (GAD1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    778442 (GAD1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    778442 (GAD1)
   00430 Taurine and hypotaurine metabolism
    778442 (GAD1)
Enzymes [BR:tgu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     778442 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS DegT_DnrJ_EryC1 OKR_DC_1 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 778442
NCBI-ProteinID: XP_002198534
Ensembl: ENSTGUG00000008060
LinkDB All DBs
Position
7
AA seq 590 aa AA seqDB search
MASSAPSSSNAAPDPTPPNLRPTTYDSWCGVAHGCTRKIGLKICGFLQRTNSLEDKGRIV
SSLKERQSSKSLLACENSEKESRFRRTETEFSNLYARDLLPSKNGEEQTMQFLLEVVDIL
LNYVKKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDNPESLEQILVDCRDTLKYGVRTGH
PRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLRKMREIIGWSNKDG
DGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVPKLVLFTSEHSHYSIKKAGAALGFG
TDNVILIKCNERGKIIPADLEAKILEAKEKGYVPLFVNATAGTTVYGAFDPIQEIADICE
KYNLWLHVDAAWGGGLLMSRKHRHKLNGIERANSVTWNPHKMMGVLLQCSAILVREKGIL
QGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQINKCL
ELAEYLYTKIKNREEFEMVFEGEPEHTNVCFWYIPPSLRGMPDSDERREKLHRVAPKIKA
LMMESGTTMVGYQPQGDKVNFFRMVISNPAATKSDIDFLIEEIERLGQEL
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctctgctccctcatcctccaacgctgctccggaccccaccccacctaatctg
cgacctacaacttacgactcatggtgcggtgtggctcacgggtgcaccaggaagatcggg
ctgaagatatgcgggttcctgcaaaggaccaacagcctggaagacaagggccggatcgtc
agctctctgaaggaaaggcagtcctccaagagcctgctggcgtgcgagaacagtgagaag
gaatccaggttccggcgcaccgagacagaattttccaatctgtatgccagagatttgttg
ccctccaagaatggtgaggagcagaccatgcagtttctgctggaggttgtggacatcctc
ctcaactacgtgaagaagacttttgacagatccaccaaagtgctggacttccaccaccca
caccagctcctggagggcatggagggtttcaacctggagctttcggacaaccctgaatcc
ctggagcagattctggtggattgtcgggacacgctgaaatacggagtgagaacaggtcat
cctcgctttttcaatcagctgtccacaggactggacattattggcttggctggggaatgg
ctgacatctactgctaatacaaacatgtttacctatgaaattgctcctgtttttgtcctc
atggaacaaataacacttcgaaagatgagggagattattggatggtcaaacaaagatggt
gatggaatattctcacctggaggagcgatctccaacatgtacagcataatggctgcacgc
tacaagtatttccctgaagttaaaaccaaaggcatggctgcagtccctaaattggttctc
tttacctcagagcatagtcactactcaataaagaaagctggagctgcacttggatttgga
acagacaatgttattttgataaaatgcaatgaaagaggcaaaataataccagctgatttg
gaggcaaaaattctggaagcaaaagaaaagggatacgttcctctctttgtaaatgcaact
gcaggcacaacagtatatggagcctttgatccaatacaggagattgcagatatatgtgaa
aaatacaacctctggctccatgtagatgctgcctgggggggtggactcttaatgtcccga
aagcaccgtcataaattgaatggaatagaaagagccaactcggtcacttggaatccacac
aagatgatgggagtgttgttacaatgttctgccattcttgtccgggagaagggtatcctt
caaggctgcaatcaaatgtgtgcaggctatctcttccagccagacaaacagtatgatgtc
tcctatgacactggagataaggcaatacagtgtggtcgacatgtagacattttcaaattc
tggttgatgtggaaagcaaagggtacagtaggatttgaaaatcagatcaataaatgcctg
gagctggcagaatatctctacactaaaatcaaaaacagagaagaatttgagatggttttt
gaaggggagccagagcatacaaacgtatgtttttggtacattcctccaagtctcaggggc
atgccagactctgatgagagaagagaaaagttacacagggtggcaccgaaaatcaaggca
ttgatgatggagtcaggtaccaccatggttggatatcagcctcagggcgataaagtcaac
ttcttccgaatggtcatctcaaacccagcagcaactaagtctgacattgacttcctcatt
gaggaaatcgagagactggggcaggagctgtag

DBGET integrated database retrieval system