KEGG   Thermococcus guaymasensis: X802_01655Help
Entry
X802_01655        CDS       T04184                                 

Definition
(GenBank) Ribulose bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
tgy  Thermococcus guaymasensis
Pathway
tgy00630  Glyoxylate and dicarboxylate metabolism
tgy01100  Metabolic pathways
tgy01120  Microbial metabolism in diverse environments
tgy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tgy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    X802_01655
Enzymes [BR:tgy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     X802_01655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N LigA
Motif
Other DBs
NCBI-ProteinID: AJC71036
UniProt: A0A0X1KIG1
LinkDB All DBs
Position
complement(295649..296983)
Genome map
AA seq 444 aa AA seqDB search
MVEKFDKIYDYYVDKSYEPNKKRDVVAVFRITPAKGYSIEAAAGAVAAESSTGTWTTLYP
WYEQERWADLSAKAYDFHDMGDGSWIVKIAYPVHAFEDGNMPGFLASVAGNVFGMKRVEW
LRLEDIYLPERFLRNYPGPNFGIEGVRKKLGIYDRPLYGVVPKPKVGYSPEELYKLALDL
FMGGADYLKDDENLTSPWYNRFEDRVKVVTKAMEKAENETGEKKTWFANITAPILELERR
LEILADYGVPHAMIDVVVLGWGVLDYVRELAEDYGIALHAHRAMHTAFARNPYHGISMFV
LAKLYRVIGVDQLHIGTAGAGKMEGEKWEVIQYKRIITEDHYVPDENDVFHLEQKFYHIK
PVFPTSSGGLHPGNIQPVIDALGKDIVLQLGGGTMGHPDGPAAGARAVRQAIDAIMQGIP
LDEYAKTHKELARALEKWGHVTPV
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggtggagaagttcgacaagatatacgactactacgtggacaagagctacgagccgaac
aagaagcgggacgttgtggctgtgttccgcataaccccagctaagggctacagcatcgaa
gcggccgcaggtgcggttgccgcggaaagctcaactggaacctggacgaccctctacccc
tggtacgagcaggagcgctgggcagacctttccgccaaagcctatgacttccacgacatg
ggcgacggtagctggatagtgaagatagcttaccccgttcacgcgtttgaggacggaaac
atgcccggcttcctcgcgagcgtggcgggcaacgtctttggaatgaagcgcgtcgagtgg
ctccgcttggaggacatatacctccctgagaggttcctccgcaactacccgggcccaaac
ttcggtatcgagggcgttagaaagaagctggggatatacgacaggcccctctacggtgtc
gttccaaagccgaaggttggctattctccggaggagctttacaaactcgccctcgacctc
ttcatgggtggcgctgactacctcaaggacgacgagaacctcacgagcccctggtacaac
cgcttcgaggatagggtcaaggtcgtcacgaaggctatggaaaaggccgagaacgagacc
ggcgagaagaagacctggttcgccaacattacagcgccaatactggagcttgagaggagg
cttgagatactcgcggactacggagtcccgcacgcaatgattgacgtcgtcgtccttggc
tggggcgttctcgactacgtgagggagcttgctgaggactacggcattgccctccacgcc
cacagggccatgcacactgccttcgctaggaacccctaccacggcatctcgatgttcgtc
ctggcaaagctctaccgcgtcataggcgttgaccagctccacatcggaaccgccggtgcg
ggcaagatggaaggggagaagtgggaggtcatccagtacaagaggataatcacggaagac
cactacgttccggacgagaacgacgtcttccaccttgagcagaaattctaccacatcaag
cccgtcttcccgacgagctccggcggccttcatcccggcaacatccagccggtcatagac
gccctcggaaaggacatcgtcctccagctcggcggtggaaccatggggcacccggacgga
ccggctgctggtgcaagggcggtcaggcaggcgatagacgcgattatgcagggcatcccg
ctcgacgagtacgccaagacccacaaggagctcgcccgcgccctcgagaagtggggccac
gtcaccccggtctga

DBGET integrated database retrieval system