KEGG   Thermococcus guaymasensis: X802_01885Help
Entry
X802_01885        CDS       T04184                                 

Definition
(GenBank) aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tgy  Thermococcus guaymasensis
Pathway
tgy00030  Pentose phosphate pathway
tgy01100  Metabolic pathways
tgy01120  Microbial metabolism in diverse environments
tgy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tgy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    X802_01885
Enzymes [BR:tgy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     X802_01885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AJC71075
UniProt: A0A0X1KIJ0
LinkDB All DBs
Position
341605..343422
Genome map
AA seq 605 aa AA seqDB search
MYGNWGKFLRVNLSTGEVKVEEYDEELAKKWLGSRGLAIYFLLRDMDPKVDPLSPENMLI
ITPGPLSGTSAPTGGRYNVVTKSPATGFITMANSGGYFGAELKFAGWDGIIVEGKADNPV
YIYIKDENVEIRDASHLWGKVVSETEKTLREEIGSKKVRILSIGPAGENLVKFAAIMNDG
HRAAGRGGVGAVMGSKNLKAIVVEGSKSVPIADRQKFMLTVREKINKLKNDPTAGGGLPK
YGTAVLVNIINENGLYPTRNFQTGVFEHAYEQSGEAMAKKYLIRNQPCYACPIGCGRVNR
LPTVGVTEGPEYESIWALGANLGINDLASIIEANHQCDEFGLDTISTGGTLAAAMELYEK
GYLTDDELGDAPPFRWGNTEVLHYYIEKIAKREGLGDKLAEGSYRFAEMYGHPEFSMSVK
KLELPAYDPRGAEGHGLGYATNNRGGCHIKNYMISPEILGYPYKMDPHDISDDKIKMLIV
FQDLTAIIDAAGLCVFTTFGLGADDYRDLLNAALGWDFTTEEYLKIGERIWNAERIFNLK
AGLDPLKDDTLPKRFLEEPMPEGPNKGHVVRLKEMLPRYYKLRGWTEDGRVPKEKAEELG
IAEFL
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgtacggaaactggggtaagtttttgcgcgtgaacctctccactggagaggtcaaagtt
gaggagtacgacgaagagcttgccaaaaagtggctcggcagcaggggactggcaatatac
ttccttctcagggacatggatcccaaggtcgacccgctcagcccggagaacatgctgata
atcacacccggcccgctcagcggaacgagcgcgcccaccggcggcaggtacaacgtcgta
acaaagagcccggcgacgggcttcataaccatggccaactccggcggctacttcggggcg
gagctcaagttcgccggatgggacggcataatagtcgaaggaaaggccgacaacccggtt
tacatctacataaaagatgagaacgtcgagatcagagacgcctctcacctctggggcaag
gtcgttagcgagaccgagaagaccctcagagaagagataggcagtaagaaggtcaggatc
ctgagcataggcccggccggtgagaacctcgtcaagttcgcggctataatgaacgacggc
cacagggcggccggtaggggtggcgtcggtgccgtcatgggaagcaagaacctcaaggcc
atagtcgttgagggaagcaagagcgtcccgatagcggacaggcagaagttcatgctcacc
gtcagggagaagataaacaagctcaagaacgaccccaccgctggaggaggccttccgaag
tacggaaccgccgtcctcgttaacattatcaacgagaacggtctctacccgaccaggaac
ttccagaccggtgtctttgagcacgcctacgagcagagcggtgaggcgatggccaagaag
tacctcataaggaaccagccatgctacgcctgtccgattggctgtggaagggtcaacagg
ctcccgacagttggcgtcaccgagggaccggagtacgagagcatctgggcgctcggtgct
aacctcggaataaacgacctcgcgagcattatcgaggccaaccaccagtgtgatgagttc
ggtctcgacacaatctcgaccggtggaactttggcggctgcgatggagctctacgagaag
ggctacctcaccgacgacgagctcggcgacgctccgcccttcaggtggggcaacacagag
gttctccactactacatcgagaagatagccaagagggaaggcctcggagacaagctcgcc
gagggaagctaccgcttcgccgagatgtacggccaccccgaattctcaatgagcgtcaag
aagctcgaacttccggcctatgacccgaggggtgccgaggggcacggcctcggttacgcc
accaacaaccgcggtggatgccacatcaagaactacatgataagcccggagatcctcgga
tacccgtacaagatggatccgcacgacataagcgacgacaagatcaagatgctcatagtc
ttccaggacctcactgccatcattgacgccgcgggactctgtgtcttcacgaccttcggc
ctcggtgcggacgactaccgcgacctcctcaacgcggcccttggctgggacttcaccacc
gaggaatacctgaagataggcgagcgcatctggaacgccgagaggatattcaacctcaag
gccggcctcgacccgctcaaggacgacaccctgccgaagcgcttcctcgaggagccgatg
ccagagggcccgaacaagggccacgtcgtcaggctcaaggagatgctcccgcgctactac
aagctccgcggctggaccgaggacggaagggttccaaaggagaaggcggaagagctcgga
attgccgagttcctctga

DBGET integrated database retrieval system