KEGG   Thermococcus guaymasensis: X802_03750Help
Entry
X802_03750        CDS       T04184                                 

Gene name
porA
Definition
(GenBank) 2-ketoisovalerate ferredoxin oxidoreductase subunit alpha
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
tgy  Thermococcus guaymasensis
Pathway
tgy00010  Glycolysis / Gluconeogenesis
tgy00020  Citrate cycle (TCA cycle)
tgy00620  Pyruvate metabolism
tgy00633  Nitrotoluene degradation
tgy00640  Propanoate metabolism
tgy00650  Butanoate metabolism
tgy00680  Methane metabolism
tgy00720  Carbon fixation pathways in prokaryotes
tgy01100  Metabolic pathways
tgy01110  Biosynthesis of secondary metabolites
tgy01120  Microbial metabolism in diverse environments
tgy01130  Biosynthesis of antibiotics
tgy01200  Carbon metabolism
Module
tgy_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tgy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    X802_03750 (porA)
   00020 Citrate cycle (TCA cycle)
    X802_03750 (porA)
   00620 Pyruvate metabolism
    X802_03750 (porA)
   00640 Propanoate metabolism
    X802_03750 (porA)
   00650 Butanoate metabolism
    X802_03750 (porA)
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    X802_03750 (porA)
   00680 Methane metabolism
    X802_03750 (porA)
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    X802_03750 (porA)
Enzymes [BR:tgy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     X802_03750 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C DUF4290
Motif
Other DBs
NCBI-ProteinID: AJC71376
UniProt: A0A0X1KJE3
LinkDB All DBs
Position
complement(652586..653770)
Genome map
AA seq 394 aa AA seqDB search
MPIRTVMKANEAAAWAAKLAKPKVIAAFPITPSTLVPEKISEFVANGELDAEFIKVESEH
SAISACVGASAAGVRTFTATASQGLALMHEVLFIAAGMRLPIVMAIGNRSLSAPINIWND
WQDSISERDTGWLQFYAENNQEALDLILIAYKVAEDERVLLPAMVGFDAFILTHTVEPVE
IPDQELVDEFLGEYEPKHAYLDPARPITQGTLAFPAHYMEARYTVWQANENAKKVIDEVF
AEFEKRFGRKYQKVEEYRTDDAEIIFVTMGSLAGTVKEYVDHLREKGIKAGAAKLTVYRP
FPIEEVRELAKKAKVLALLEKNVTFSVGGALFQDFSRALINQEEKPKIVDFILGLGGRDV
TFKDLDEALAIAQKALNGEKVDEVNWIGLRKEIL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgccgattaggaccgttatgaaggcaaatgaagctgctgcctgggccgcgaagcttgcc
aagccgaaggttatagccgcgttccccattaccccgtcaaccctcgtccccgagaagata
agtgagttcgtcgccaacggagagctcgatgcggagttcatcaaggtcgagagcgagcac
tccgctatttccgcctgtgttggtgcttccgccgccggcgttaggacattcaccgctacc
gcttctcagggtctagccctgatgcacgaggtgctcttcatcgccgccggaatgaggctt
cctatagtaatggccattggaaaccgttctcttagcgctccgatcaacatctggaacgac
tggcaggacagcataagcgagcgcgacacgggatggctccagttctacgccgagaacaac
caggaagctctggaccttattctgatagcctacaaggtcgccgaggacgagcgcgttctc
ctcccagcgatggtcggcttcgacgccttcatcctgactcacaccgtcgagcccgtcgag
atacccgaccaggagctcgttgacgagttcctcggcgagtacgagccgaagcacgcctat
ctcgacccggccaggccgatcactcagggtacgctcgccttcccggcccactacatggaa
gctagatacaccgtctggcaggccaacgagaacgccaagaaggtcatcgacgaggtcttt
gctgagttcgagaagcgctttggtagaaagtaccagaaggttgaggagtacaggactgac
gacgccgagataatcttcgtcaccatgggctccctcgccggaaccgtcaaggagtacgtt
gaccacctccgcgagaagggcatcaaggccggtgctgcgaagctcaccgtttacagaccg
ttcccaattgaggaggtcagggagctcgccaagaaggccaaggtcttggctctcctcgag
aagaacgtcaccttcagcgtcggtggagctctcttccaggacttcagcagggccctcatc
aaccaggaggagaagccgaagatcgttgacttcatcctcggccttggaggaagggacgtc
accttcaaggacctcgacgaggccctcgcgatcgctcagaaggccctaaacggagagaag
gttgatgaggtcaactggataggacttaggaaggagatcctgtga

DBGET integrated database retrieval system