KEGG   Thermococcus sp. AM4: TAM4_12Help
Entry
TAM4_12           CDS       T01638                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
tha  Thermococcus sp. AM4
Brite
Enzymes [BR:tha01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     TAM4_12
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_ligase DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: EEB73724
UniProt: B7R2S2
LinkDB All DBs
Position
complement(1277849..1278991)
Genome map
AA seq 380 aa AA seqDB search
MVGSTFRNLLLKLGLPEERLEILEGKGGLMEDEFEGIRYLRFRDSARGFRRGTVVFEDGT
VVAGFPHIKRIVQLENGIRRVFKGRPFYVEEKVDGYNVRVVKVRGRILALTRGGFVCPFT
TERILDFVNEEFFRDYPNLILVGEMAGPESPYLVEGPPYVKEDIKFFLFDVQEKGTGRSV
PVEERLKLAEEYGIDHVEVFGLYDRSRMDELYDLIERLSGEGREGIVMKTPDMRRIAKYV
TPYANINDIRIGSHIFFDLPHGYFMQRIKRLAFYLAEKRIRGEEFDEYAKALGRALLQPF
VESIHEVAGGGEVEETFRVRVKNVSTAHRMVTHFERLGVKIHIEDIEDLGNGYWRITFKR
VYPDATREIRELWNGLAFVD
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggtcggttcgacgtttcgaaacctcctcctgaaactcggcctcccggaggagaggctt
gaaatccttgagggcaagggcggccttatggaagacgagttcgagggcataagatacctc
cgcttccgcgattcggccagggggttcaggagggggaccgttgtattcgaggacggcacc
gtcgtcgcgggttttccgcacataaagaggatcgtccagcttgagaacgggataaggcgg
gttttcaagggcagacccttctacgtcgaggagaaggtcgacggctacaacgttcgcgtc
gtcaaggtcaggggcaggattttggcgctcacgaggggcggtttcgtctgtcccttcacg
accgagaggatcctcgacttcgttaatgaggagttcttcagggactaccccaacctgatt
ctcgttggcgagatggccgggccggagagcccttacctcgttgagggaccgccctacgtc
aaagaggacatcaagttcttcctgttcgacgttcaggaaaagggaaccggcaggagcgtt
ccagttgaggagaggctcaaacttgcggaggagtacggcattgatcacgtggaggtcttc
ggtctctacgaccgctcgaggatggatgagctctacgacctcatcgagaggctgagcggg
gagggcagagagggcatcgtgatgaagacgcccgatatgcggaggatagcgaagtacgtg
acgccctacgccaacatcaacgacatcaggataggctcccacatattctttgatctgccc
cacggctacttcatgcagaggatcaagaggctggccttctatctggctgaaaagcgcatc
aggggcgaggagttcgacgaatacgcgaaggccctcggtagggcccttctccagcccttc
gtcgagagcattcacgaagttgccggcgggggggaggtggaggagaccttccgggtcagg
gtgaagaacgtgagcaccgcccacaggatggttacccactttgagaggctcggagttaag
atccacatcgaggacatcgaggacctcggaaacggctactggaggataaccttcaagcgc
gtttatccggacgcaacgcgcgagataagggagctttggaacggcctggcgttcgtggat
tga

DBGET integrated database retrieval system