KEGG   Thermococcus sp. AM4: TAM4_1567Help
Entry
TAM4_1567         CDS       T01638                                 

Definition
(GenBank) DNA double-strand break repair rad50 ATPase
  KO
K03546  DNA repair protein SbcC/Rad50
Organism
tha  Thermococcus sp. AM4
Brite
KEGG Orthology (KO) [BR:tha00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tha03400]
    TAM4_1567
DNA repair and recombination proteins [BR:tha03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     TAM4_1567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SMC_N AAA_15 Rad50_zn_hook AAA_29 AAA_21 ABC_tran Sec34 VRR_NUC DUF724 SbcCD_C Med9 RsgA_GTPase AAA_13
Motif
Other DBs
NCBI-ProteinID: EEB74200
UniProt: B7R252
LinkDB All DBs
Position
complement(1026183..1028840)
Genome map
AA seq 885 aa AA seqDB search
MRVRKIEIRNFRAHRKSVVEFSDGINLIIGQNGAGKSSILEAIFASLYLGHPSFPKGYLK
ANARVGTGELSLSLEFEHNGKTYRITRTTKKSELLENGRLIAEKSSDIARWVERNVYPLQ
IYTNALYIRQGEIEGIITNREVMEKVLRKVLGIEDYENAERNSADVIRELKRRKENLKRL
IERKAEIEENLRDAEKRFAETLRKISELRKRERELSAEVEKLSKLYQEMKERKELITSLE
KRIALLEKSLASEEKLLREREKRIGELKLELEELEEKKARLEELKPLAEEYTELGRLLKL
KDELSKVEVGLSSLREKLRSLERETAKRAELEKKLEELKKKEAETRREYERLKERHRLYQ
RALSILGEAEKHRKELERAGYTVEKLEKELKEIEEAKEELEKLQEEISKVREKIASLKGK
KAELMANMERLEGAKICPLCRRPIDEHEEGEILAEYRAEISRIEGEVKTLEEELEGLKKR
EVELRKLLAKEPKLIRLKKTADLLREAEEKLEELGVEELERDAELFEETKEKLIGLKKEI
RGVRERLEELEGLEKEKEEVEKELHALEERKADILKRLSERGFKSFEEVEERIGELEKPY
REFLSLKDVPRRIEVLERKLDVERRKADESRANMERLKAELGKAREELEEAREDFSEEDF
ERAEREYLEKSRVLERARAEREGAESLRDEIARLIDELKANLWEIEKAEKELELVEKALS
DITAFREKIARLKAEEELRGLEEVQKLAGELFSEMTEGKYQGIRLRREKKYGKERIELKV
LYAGNEVGIDFLSGGERIALGLAFRLALSLYKVGNLELLILDEPTPFLDEERRKKLVEII
SSQLRKIPQVIIVSHDEELKDAADYVIRVTNAGEARVEVESLGAY
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atgagggtcaggaaaatcgagattcggaacttcagggcccacaggaaaagcgttgtcgag
ttcagcgacggcataaacctgataatcggccagaatggagcgggaaagagctcaatcctt
gaggccatcttcgcctcgctttacctcggacacccgagcttcccgaagggttacctgaag
gccaacgctcgcgtcggaaccggtgagctttccctgagcctggaattcgagcacaacggc
aaaacctaccgcataaccagaacaacgaagaagagcgagctcctcgagaacggacggctc
atcgcggagaagagctcagatatagcgcgctgggtcgagcggaacgtttaccccctgcag
atctacacgaacgcgctctacattcgacagggcgagattgagggcataatcaccaaccgc
gaggtcatggagaaggttctgcgcaaggttctcggcatagaggactacgagaacgccgag
aggaactcggccgatgtaatccgcgagctgaagaggaggaaggagaacctcaagaggctc
atcgagaggaaagccgaaatcgaggagaacctcagggatgccgagaagaggtttgccgag
acgctgagaaagattagcgagctgaggaagagggaaagggagctttcggccgaggtggag
aagctttccaagctctatcaagagatgaaggagaggaaagagctgataaccagccttgag
aagaggatagctctcctcgaaaaatcgctggcgagcgaggagaaacttttgagggagagg
gagaagaggataggggagctgaagctcgagctcgaggagctggaggagaagaaggcgaga
ctcgaggagctgaagcccctcgcagaggaatacaccgagctcggcagacttctcaaactg
aaggacgagctttcgaaggttgaggttgggctttcctcgctgagggagaagctccgctcc
ctcgagagggaaacggcgaagcgtgctgagctggagaaaaagcttgaggagctgaagaag
aaagaggctgagacgaggagggaatacgagaggctcaaggagaggcacaggctctaccag
cgtgccctgtcaatcctcggtgaggccgagaagcacaggaaggaactcgagagggccggc
tacaccgtcgagaagcttgagaaggaactcaaagaaatcgaggaagccaaggaggagctt
gaaaaactccaggaggagatttcgaaggtcagggagaagatagcctcgctgaaggggaaa
aaggcggagcttatggccaacatggagaggctggaaggggccaaaatctgccccctttgc
agaaggcccatagacgagcacgaggaaggcgaaatcttggcagaatacagggctgagata
tcgaggattgagggggaagttaaaacccttgaggaggaactcgaagggctgaaaaagcgc
gaggttgagctcaggaagctcctcgcgaaagagccaaagctaatccgcctcaagaagacg
gccgatttgctcagggaggcggaggaaaagcttgaggagctcggcgttgaggagcttgag
agggacgccgaactcttcgaggaaacgaaggagaaactcatcggtctcaagaaggaaatc
cggggcgtgagggagaggcttgaggagcttgagggccttgagaaggaaaaggaagaagta
gagaaggaacttcacgccctcgaggagagaaaggctgacattctaaagaggctctccgag
agggggtttaagtccttcgaggaggttgaggagaggattggggagctcgagaagccctac
cgcgagttcctctcgctgaaggacgttccaaggaggattgaggtcctcgagaggaagctc
gacgtcgagcggaggaaggccgatgaatcaagggcgaacatggagcgcctgaaggccgag
ctcggaaaggcgagagaagagctggaggaagccagagaggacttctcggaggaggacttc
gagagggccgagagggaataccttgagaaatcgagagtccttgagagggcgagggccgag
cgtgaaggggcggaaagcctgagggacgagatagctcgcttaatagacgagctgaaggcg
aacctctgggagattgaaaaggccgagaaagagctcgagctcgtcgagaaggccctctcg
gatataacggccttcagggagaagatagcccggctgaaggcggaggaagagctgaggggc
cttgaagaggtgcagaagctggccggagagctgttctcggagatgaccgagggcaagtat
caggggataaggctgaggcgcgagaagaagtacggaaaggagaggattgagctcaaagtc
ctctacgcgggcaacgaggtgggaatagacttcctcagcggtggggagagaatagcgctc
ggtctggccttccgccttgccctctcgctctacaaggtgggcaaccttgagctcctcata
ctggacgagccgacgccattcctcgacgaggagaggaggaagaagctcgtggagattata
tcaagccagctgaggaagataccgcaggtaatcatcgtctctcacgacgaagagctgaag
gacgcggccgactacgtgataagggttaccaacgccggtgaagcaagggtggaggtggag
agccttggagcgtattga

DBGET integrated database retrieval system