KEGG   Thermococcus sp. AM4: TAM4_1764Help
Entry
TAM4_1764         CDS       T01638                                 

Definition
(GenBank) Ribulose-1,5-bisphosphate carboxylase Type III
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
tha  Thermococcus sp. AM4
Pathway
tha00630  Glyoxylate and dicarboxylate metabolism
tha01100  Metabolic pathways
tha01120  Microbial metabolism in diverse environments
tha01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    TAM4_1764
Enzymes [BR:tha01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     TAM4_1764
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: EEB74397
UniProt: B7R258
LinkDB All DBs
Position
complement(1048696..1050030)
Genome map
AA seq 444 aa AA seqDB search
MVEKFDKIYDYYVDKGYEPNKKRDIIAVFRVTPAEGYTIEAAAGAVAAESSTGTWTTLYP
WYEQERWADLSAKAYDFIDMGDGSWIVRIAYPFHAFEEWNLPGLLASIAGNVFGMKRVKG
LRLEDLYIPEIVLRNFNGPAFGIEGVRKMLEIYDRPLYGVVPKPKVGYSPEEFEKLAYEL
LSNGADYMKDDENLTSPWYNRFDERAEIVARVIDKVENETGEKKTWFANITADVREMERR
LEILADLGLKHAMVDVVITGWGALEYIRDLAADYGLAIHGHRAMHAAFTRNKYHGISMFV
LAKLYRIIGIDQLHVGTAGAGKLEGGKWDVIQNARILREETYTPDENDVFHLEQKFYGMK
PAFPTSSGGLHPGNIEPVIEALGKDIVLQLGGGTLGHPDGPGAGARAVRQAIDAIMQGIP
LDEYAKTHKELARALEKWGHVTPV
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggttgagaagttcgacaagatatacgactactacgtggacaagggctacgagccgaac
aagaagagggacataatagcggttttccgcgttacccctgctgagggatacaccatcgag
gcggccgcaggtgcagtcgccgccgagagctcgaccggaacctggacgaccctttacccc
tggtacgagcaggagcgctgggccgacctttcagctaaggcctacgacttcatcgacatg
ggcgacggaagctggatcgtcaggatcgcctacccgttccacgccttcgaggagtggaat
ttaccgggccttctcgcgagtatagccggaaacgtcttcggaatgaagcgcgttaagggt
cttcgccttgaggacctctacattcccgagatagtcctcaggaacttcaacgggccggcc
ttcggtatcgagggcgtcaggaagatgctcgaaatctatgacagacccctctacggcgtc
gtccccaagcccaaggtaggctactcgccggaggagtttgaaaagctagcctacgagctc
ctctccaacggtgcggactacatgaaggacgacgagaacctcacgagcccctggtacaac
cgcttcgacgagagggcggagatagtggcgagggtcatcgacaaggtcgagaacgagacc
ggcgagaagaagacctggttcgccaacatcaccgcagacgttcgcgagatggagaggcgc
cttgagattctggcagacctcggactcaagcacgcgatggttgacgtcgtcataaccggc
tggggagcgctcgagtacatccgcgacctggcggccgactacgggctggccattcacggc
cacagggcgatgcacgcggccttcacgaggaacaagtaccacggcatctcgatgttcgtc
ctggccaagctctacaggattataggaattgaccagctccacgttggaaccgccggcgcc
ggaaagctcgagggtggaaaatgggacgtcatccagaacgcgaggattctcagggaggaa
acctacaccccggacgagaacgacgtcttccacctcgagcagaagttctacggcatgaag
ccagccttcccgaccagctcaggcggtctccacccgggcaacatcgagccggtcatagag
gccctcggaaaggacattgttttacagctcggcggtggaaccctcggccacccggacgga
ccgggagcgggagcgagggcggtaagacaggccatcgacgccataatgcagggaatcccg
ctcgacgagtacgccaagacccacaaggagctcgctcgcgccctcgagaagtggggccac
gtcacgccggtctga

DBGET integrated database retrieval system