KEGG   Thalassococcus sp. S3: CFI11_08835Help
Entry
CFI11_08835       CDS       T05844                                 

Definition
(GenBank) haloacid dehalogenase
  KO
K01091  phosphoglycolate phosphatase [EC:3.1.3.18]
Organism
thaa  Thalassococcus sp. S3
Pathway
thaa00630  Glyoxylate and dicarboxylate metabolism
thaa01100  Metabolic pathways
thaa01110  Biosynthesis of secondary metabolites
thaa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:thaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CFI11_08835
Enzymes [BR:thaa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.18  phosphoglycolate phosphatase
     CFI11_08835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_like Hydrolase_6 NIF
Motif
Other DBs
NCBI-ProteinID: QBF31322
UniProt: A0A4V0Z9I5
LinkDB All DBs
Position
1779184..1779846
Genome map
AA seq 220 aa AA seqDB search
MKTVIFDLDGTLADTSGDLIAAANVCFRQMGLGDVLDPVADAGIALRGGRRMLTAGLERH
GRFDEDTVTEYYPVLLDAYAEAIDVHTVLYPGAMDAVEALKTNGYGVGICTNKPEALAET
LMTRLGVRGQFAALVGADTLPVRKPDPEPLREAARRAGGHPEQTLLVGDSDTDRNTARAA
GVPSILVTFGPSGEDMAALEPEALLHSYEALPMVVDSLIG
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
gtgaagacggttatcttcgatctggacggaacgctggcggatacaagcggtgacctgatc
gcggcggcgaatgtgtgctttcggcagatggggctgggcgatgtgcttgatcctgtcgcg
gatgcggggatcgctttgcgcggcgggcggcgcatgctgacagccggtctcgagcggcac
gggcgttttgatgaggacaccgtcacggaatactatcccgtcttgctggacgcctatgcc
gaggcgatcgatgtgcatacggtcctttatcctggtgcgatggatgctgttgaggccctg
aaaaccaacggctacggcgttggtatttgcaccaacaaacccgaagccttggctgaaaca
ctcatgacgcggctcggggtgagggggcaattcgcagcgcttgtcggggctgatacgctg
ccggtacgcaagccggatccggaacccttgcgggaagcggcacggcgcgcgggagggcat
ccggagcagacccttctggtgggcgattccgacacggaccgcaacacggcccgggccgcg
ggcgtgccctcgatccttgtgacgttcggcccatcgggtgaggatatggcagcccttgaa
cccgaggcgcttctgcattcctacgaggcgctgccaatggtggtcgacagcctgatcggt
tga

DBGET integrated database retrieval system