KEGG   Thalassococcus sp. S3: CFI11_12385Help
Entry
CFI11_12385       CDS       T05844                                 

Definition
(GenBank) peptide ABC transporter ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
thaa  Thalassococcus sp. S3
Pathway
thaa02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:thaa00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CFI11_12385
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:thaa02000]
    CFI11_12385
Transporters [BR:thaa02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    CFI11_12385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_21 SMC_N AAA_22 Mg_chelatase
Motif
Other DBs
NCBI-ProteinID: QBF32013
UniProt: A0A4P6MH65
LinkDB All DBs
Position
complement(2490583..2491533)
Genome map
AA seq 316 aa AA seqDB search
MSLLEISDLTVAFEAGQALRALSLSVGAGERIGLVGESGSGKTMAGLAVMGMVPEAANVT
GEIRYDGTPLHPRQMAPLRGREIAMIFQEPMTALNPLQTIGRQITEPMIWHGLAKGRAAR
ARALDLLREVDMPDPEARLRQYPHQLSGGQRQRAMIALALACGPRLVIADEPTTALDPVR
AEQILDLLARLSREREMALILISHDLTAVERSVERLAVLYAGDKVEEGPVGQVLSAPAHP
YTQGLVAARPRLRLTGPRHKLPTIQGVVPPLAELGQGCRFHGRCPIGTDACLQARPALIE
AGPNQRAACICMGVDA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgcttgagatcagcgacctgaccgtcgccttcgaggccgggcaggccctgcgc
gcgctgtcgctgtccgtcggggctggagagcggatcgggctggtcggcgaaagcgggtct
ggcaagacgatggcggggctggccgtcatgggcatggtgcccgaagcggccaatgtgacc
ggagagatccggtatgacggcacgccgctccacccccggcagatggcaccgctcagaggg
cgggagatcgcgatgatctttcaggagccgatgacggcgctaaatccgctccagaccatc
gggcgccagatcaccgagccgatgatctggcacggcctcgccaagggccgcgccgcacgg
gcgcgggcgctggatctgctgcgcgaggtcgacatgccggacccggaggcgcggctgcgc
caatacccccatcagctttcgggcgggcagcggcagcgggcgatgatcgcgctggcgctc
gcctgcgggccgcgtctggtgatcgcggatgagccgacgacagctttggatccggtcagg
gccgaacagatcctcgacctgctcgcccgcctgtcgcgggagcgggagatggcgctgatc
ctgatcagtcacgacctgacggcggtggagcggagcgtggaaaggcttgccgtgctttat
gcaggcgacaaggtagaagaggggccggtggggcaggtcctatccgcgcctgcgcatcct
tatacgcaaggtttggtcgccgcacggccacggctgcgccttacgggtccgcgacacaag
ctgccgacgatccaaggcgttgtgccgccgcttgcggaactggggcagggctgtcggttc
cacgggcgctgccccatcgggaccgatgcctgcctgcaagcgcgccccgcgctgatcgag
gccggcccgaaccagcgcgccgcctgcatctgcatgggggtcgacgcatga

DBGET integrated database retrieval system