KEGG   Thalassococcus sp. S3: CFI11_13280Help
Entry
CFI11_13280       CDS       T05844                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
thaa  Thalassococcus sp. S3
Pathway
thaa00061  Fatty acid biosynthesis
thaa00780  Biotin metabolism
thaa01100  Metabolic pathways
thaa01130  Biosynthesis of antibiotics
thaa01212  Fatty acid metabolism
Module
thaa_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:thaa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CFI11_13280
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CFI11_13280
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CFI11_13280
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:thaa01004]
    CFI11_13280
Enzymes [BR:thaa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     CFI11_13280
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     CFI11_13280
Lipid biosynthesis proteins [BR:thaa01004]
 Fatty acid synthase
  Component type
   CFI11_13280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: QBF32183
UniProt: A0A4P6MHL4
LinkDB All DBs
Position
2656349..2657155
Genome map
AA seq 268 aa AA seqDB search
MSIELMSGKRGLIMGLANDKSIAWGIAKACANAGAELAFSFQGDALKKRVEPLAAQLGSS
IVLPCDVTDEASIDALFDALKEEWGQLDFIVHAIGFSDKSELRGRYVDTSRANFAMSMDI
SVYSFTAVVQRAEKMMNEGGSCLTLTYYGAERVMPHYNVMGVAKAALEASVRYMAEDLGK
DGIRVNAISAGPIKTLAASGIGDFRYIMKWNEYNSPLRRNVTIDDVGGSALYLLSDLGAG
VTGEVLHVDAGYHVVGMKAVDAPDMTKG
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattgaactcatgtcaggcaaacgcgggctgatcatggggttagccaatgacaag
tccattgcctggggcatcgccaaggcctgcgccaatgccggcgccgaattggccttctcc
tttcagggtgatgcgctgaaaaagcgggtagagccgctggcggctcagcttggcagcagc
atcgtgctgccctgcgacgtgaccgacgaagcctccatcgacgcgcttttcgatgctctg
aaagaggaatgggggcagctcgatttcatcgtccatgccatcggcttttccgacaaatcc
gaattgcgcggccgctacgtcgacacgtcgcgcgcgaatttcgctatgtcgatggacata
tcggtctactcctttaccgccgtggttcagcgcgcggaaaagatgatgaacgaaggcggg
tcctgcctcaccctcacctattacggcgccgaacgggtcatgccgcattacaacgtgatg
ggcgtggccaaggccgctctggaagcgtcggtgcggtatatggccgaagatctgggcaag
gacggcatccgcgtgaacgcgatctcggccggtccgatcaagacgctggccgcttcgggc
atcggcgattttcgctacatcatgaagtggaacgagtacaattcgcccctgcggcgcaac
gtgaccatcgacgatgtgggcggctcggcactctatctgctcagcgatctgggcgccggc
gtgaccggagaggtgctgcatgtcgatgccggctaccacgtggtcggcatgaaagccgtc
gacgcccccgacatgaccaagggctag

DBGET integrated database retrieval system