KEGG   Thalassococcus sp. S3: CFI11_17710Help
Entry
CFI11_17710       CDS       T05844                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K03153  glycine oxidase [EC:1.4.3.19]
Organism
thaa  Thalassococcus sp. S3
Pathway
thaa00730  Thiamine metabolism
thaa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thaa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    CFI11_17710
Enzymes [BR:thaa01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.19  glycine oxidase
     CFI11_17710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO NAD_binding_8 FAD_binding_2 Amino_oxidase HI0933_like Pyr_redox_2 Thi4 GIDA FAD_binding_3 FAD_oxidored Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: QBF33044
LinkDB All DBs
Position
3579369..3580337
Genome map
AA seq 322 aa AA seqDB search
MFQIAGAGLAGLACGYELARRGARVVIYEAAQTVGTKSVARFAGGMLAPWCERESAEEDV
IRLGAGSADWWSDITPVERRGTLVVATGRDQAELTRFAQRTSGHRSVSAGDIAALEPDLE
SRFQRGLFFENEAHLDPRRALCDLADAVEALGGEIRRGENAPDDVDIDCTGMAADISGLR
PVRGEMAILCCPEVTLSRTVRLLHPRIPLYLVPRADGHYMIGATMIESSSTRAATLRSLS
ELFSAAFTLHPAFAEAAIVETGAGLRPAFADNLPRVTHVQGKWHLNGLYRHGFLLAPAMA
KSLAQKLLSETDHENHRERRTA
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atcttccagattgccggggccggccttgcggggctggcctgcggctacgaattggccagg
cgcggcgcgagggttgtgatctatgaggcggcgcaaacggttgggacgaaaagcgttgcc
cgtttcgccggcggcatgctcgcgccctggtgcgaacgagaaagtgccgaagaggatgtg
atccgactgggcgccggaagtgccgattggtggtcagacatcacacccgtcgaacggcgc
ggcacattggtcgtcgccacaggcagggatcaggcggagcttacccgcttcgcccaacgc
accagcgggcaccgttcggtgagcgccggcgacatcgccgccctggagccggaccttgag
agccgatttcagcgcgggcttttctttgaaaacgaagcgcatctcgatccgcgacgcgcc
ctttgcgatctcgcagacgccgtagaggctttgggcggcgagatcaggcgtggcgagaac
gcgccggatgatgtcgatatcgactgcaccgggatggccgcagatataagcggcctaaga
cccgttcgcggtgaaatggcgattctgtgctgccccgaagtgaccctctcgcgtactgtg
aggctgcttcatccacgcataccgctttacctcgtacctcgcgcggacgggcattacatg
atcggcgccacgatgatcgaaagcagctcgacgcgcgccgcgacactcagatccctgagc
gagcttttctcggccgccttcacacttcaccccgcctttgctgaggctgcgatcgtcgaa
acgggggccggccttcggcctgcctttgccgacaatctcccccgcgtgacccatgtgcag
ggaaagtggcatctgaacgggttgtatcgacatggcttccttctggccccggccatggcc
aaatcgctggcgcagaaactcttatcggagaccgatcatgaaaatcatcgtgaacgccga
accgcttga

DBGET integrated database retrieval system