KEGG   Thalassococcus sp. S3: CFI11_20775Help
Entry
CFI11_20775       CDS       T05844                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
thaa  Thalassococcus sp. S3
Pathway
thaa00020  Citrate cycle (TCA cycle)
thaa00190  Oxidative phosphorylation
thaa00650  Butanoate metabolism
thaa01100  Metabolic pathways
thaa01110  Biosynthesis of secondary metabolites
thaa01120  Microbial metabolism in diverse environments
thaa01130  Biosynthesis of antibiotics
thaa01200  Carbon metabolism
Module
thaa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
thaa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
thaa_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:thaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CFI11_20775
   00650 Butanoate metabolism
    CFI11_20775
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CFI11_20775
Enzymes [BR:thaa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CFI11_20775
    1.3.5.4  fumarate reductase (quinol)
     CFI11_20775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_7 Fer4_9 Fer4_16 Fer2 Fer4_18 Fer4_22
Motif
Other DBs
NCBI-ProteinID: QBF33629
LinkDB All DBs
Position
complement(4209885..4210664)
Genome map
AA seq 259 aa AA seqDB search
MVQLTLPKNSRIKTGKTWPKPDGATNLRKFSIYRWNPDDGENPRVDTYWVDMDTCGPMVL
DALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGINTLACIYGMDEIKGDVKIYPLPHMP
VVKDLIPDLTHFYAQHASIMPWLETKTNRPAKEWRQSIEDRKKLDGLYECVMCASCSTAC
PSYWWNGDRYLGPAALLHAYRWIIDSRDEATGERLDDLEDPFKLYRCHTIMNCAKTCPKG
LNPAKAIAEIKKMMVERTV
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggttcaactgacactcccgaaaaactcgcgcatcaagacgggcaagacctggcccaaa
ccggacggcgcgaccaacttgcgcaaattcagcatttatcgctggaaccccgatgacggg
gagaacccccgcgtggacacctattgggtggacatggacacttgcgggccgatggttctg
gatgcgctgatcaagatcaagaacgagatcgatccgacgctgaccttccgtcgttcgtgc
cgcgaggggatttgcggatcctgcgcgatgaacatcgacgggatcaatacgctggcctgc
atctacggcatggatgagatcaagggcgacgttaagatctatccgctgccgcatatgccg
gtggtcaaggacctgatcccggatctgacgcatttctacgcgcagcacgcgtcgatcatg
ccctggcttgagaccaagacaaaccgaccggcgaaggaatggcgacagtcgatcgaggat
cgtaagaaactcgacgggctctatgaatgcgtgatgtgtgcgtcatgctcgacggcgtgt
ccctcgtattggtggaacggggatcggtatctggggccggcagctctgctgcacgcctat
cgctggattatcgacagccgggacgaagcgaccggagagcggctggatgatctggaggat
cctttcaagctttatcggtgccacacgatcatgaactgcgcgaagacctgtccaaagggg
ctgaacccggccaaggcgattgccgagatcaagaagatgatggtcgagcgcacggtctga

DBGET integrated database retrieval system