KEGG   Thalassococcus sp. S3: CFI11_20795Help
Entry
CFI11_20795       CDS       T05844                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
thaa  Thalassococcus sp. S3
Pathway
thaa00020  Citrate cycle (TCA cycle)
thaa00190  Oxidative phosphorylation
thaa00650  Butanoate metabolism
thaa01100  Metabolic pathways
thaa01110  Biosynthesis of secondary metabolites
thaa01120  Microbial metabolism in diverse environments
thaa01130  Biosynthesis of antibiotics
thaa01200  Carbon metabolism
Module
thaa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
thaa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
thaa_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:thaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CFI11_20795
   00650 Butanoate metabolism
    CFI11_20795
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CFI11_20795
Enzymes [BR:thaa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CFI11_20795
    1.3.5.4  fumarate reductase (quinol)
     CFI11_20795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 FAD_binding_3 Thi4 DAO HI0933_like FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: QBF33633
LinkDB All DBs
Position
complement(4212151..4213956)
Genome map
AA seq 601 aa AA seqDB search
MAAYDYETHEYDVVVVGAGGAGLRATLGMAEQGLRTACVTKVFPTRSHTVAAQGGIAASL
GNMGPDSWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKIYQR
PFGGHTTEFGEGPPVQRTCAAADRTGHAILHTLYGQSLKNNAEFYIEYFAIDLIMDDDGV
CQGVLCWKLDDGTLHLFAAKMVVLATGGYGRAYFSATSAHTCTGDGGGMTARAGLPLQDM
EFVQFHPTGIYGAGCLITEGARGEGGYLTNSEGERFMERYAPTYKDLASRDVVSRCMTME
IREGRGVGKDGDHIHLHLNHLPPETLAERLPGISESARIFAGVDVTKEPIPVLPTVHYNM
GGIPTNYWGEVLAPTKDNPDHVAPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAI
RAGQVVDPKTAVPTPNRRSVEAALSRFDGLRYAKGHVPTAELRLEMQKTMQQDAAVFRTD
KTLAEGQEKMEGVAEKLSDVKVTDTSMVWNSDLMETLELTNLMPNAVATITAAAARKESR
GAHAHEDYPDRDDETWRKHSLVWFKGNQASLGYRGVHLNPLTSHNDGGIDLKKIAPKARV
Y
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atggctgcatatgattacgagacgcatgaatatgacgtcgtggtcgtgggcgctggcggc
gcggggttgcgcgccacactcggcatggcggaacagggcctgcggacggcctgtgtaacc
aaggtgttccccacccggtcgcacacggtggcggcccagggcggcatcgcggcgagcctt
ggcaatatgggcccggacagctggcagtggcatatgtacgacaccgtgaaggggtcggac
tggctgggcgatacggatgcgatggaatacctcgctcgcgaggcgcccaaggcggtctac
gagctggagcactacggtgtgcccttctcgcgtaccgaagagggcaagatctatcagcgg
ccttttggcgggcataccacggaattcggcgaaggccccccagtgcagcgcacctgtgcg
gccgccgaccgcacgggccacgcgatcctgcatacgctttacgggcaaagtctgaagaac
aacgcggaattctacatcgagtatttcgccatcgacctgatcatggacgatgacggggtc
tgccagggcgttctctgctggaagctggatgacggcacactgcaccttttcgcggccaag
atggtggtgctggccacgggcggttatggccgcgcctatttcagtgcgacctccgcccat
acttgcacgggcgacggcggcggcatgacggcccgcgcaggtctgccgctgcaagatatg
gaattcgtgcagttccacccgacaggtatctatggcgccggctgcctgatcaccgaaggt
gcacgcggcgagggcggctacctcaccaactccgaaggtgagcggttcatggagcgctat
gcgccgacctacaaggacctcgcctctcgcgatgtggtgtcacgctgcatgacgatggag
atccgcgaagggcgcggtgtgggcaaggacggtgatcacattcacctccacctcaaccac
ctgccccccgaaacgctggctgaacgtttgccgggtatttcggaaagcgcacggatcttc
gcaggtgtcgatgtcacgaaagagccgatcccggttctgccgactgtgcattacaatatg
ggcggcattcccaccaactattggggcgaggttctggcgccgaccaaggataaccccgat
cacgtcgcaccgggcctgatggctgtgggtgaggcaggctgcgcttcggtgcatggggcg
aaccggctgggctcaaactcgctgatcgacctcgtcgtctttggccgggccgcggcgatc
cgcgcgggtcaggttgtcgatccgaagacagccgtgccgacgccgaaccggcggtcggtc
gaagccgcgctcagccgctttgacgggctgcgctatgccaaagggcacgtgcccacggcg
gaactgcggttggagatgcagaagacgatgcagcaggacgctgcggtcttccggaccgac
aaaacgctggccgagggtcaggagaagatggaaggcgtggccgagaagctgtcggatgtg
aaagtgacggacacctccatggtctggaattcagacctgatggagacgctggagctgacc
aacctgatgcccaacgccgtggccacgatcaccgcggccgccgcgcggaaggagagccgg
ggcgcgcatgcgcatgaggactaccccgaccgcgatgatgagacctggcgcaagcacagc
ctggtctggttcaaaggcaatcaggcgagccttggctatcgcggcgtgcatctcaacccg
ctcaccagccacaatgatggcggcatcgacctgaagaaaatcgcgccgaaagcgcgggtt
tactga

DBGET integrated database retrieval system