KEGG   Thalassococcus sp. S3: CFI11_23780Help
Entry
CFI11_23780       CDS       T05844                                 

Definition
(GenBank) L-idonate 5-dehydrogenase
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
thaa  Thalassococcus sp. S3
Brite
KEGG Orthology (KO) [BR:thaa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CFI11_23780
Enzymes [BR:thaa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     CFI11_23780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Methyltransf_25 2-Hacid_dh_C AlaDh_PNT_C Methyltransf_11 Methyltransf_31 PrmA
Motif
Other DBs
NCBI-ProteinID: QBF34208
UniProt: A0A4P6ML61
LinkDB All DBs
Position
pS3A:complement(63582..64613)
Genome map
AA seq 343 aa AA seqDB search
MKAIVIHAAKDLRIEDHEHADPGPGEVLVSVAAGGICGSDLHYFQHGGFGTVRLRQPMIL
GHEVSGHVDRVGADVTGLEEGQLVAISPSRPCQSCRFCHAGQHNHCLNMRFYGSAMPFPH
IQGAFREKLVADATQCVPAEGLSAGEAAMAEPLSVCLHAAKQAGDIMGKRVLVTGCGPIG
LLVILVARAAGAAEVVATDLTPFTLQKAREIGADLAVNVAEASDPLSAFQADRGHFDVLF
ECSGAAAALASAVPAMRPGGVIVQLGLGGDMTLPMQAMTAKELEIRGSFRFHAEFPLAVE
MMRKGFIDVSPLITHSFDMKDAVPAFQMASDRSQAIKAQIRFG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccatcgttatccacgccgcgaaggatctcaggatcgaggatcacgaacatgcc
gatcccggccccggtgaggttctcgtgtcagtagcggcgggcggcatctgcgggtcggac
ctgcattattttcagcatggtgggtttggcactgtccggctgcgtcagcccatgatcctg
ggtcacgaagtgtccggccacgttgaccgggtgggcgccgacgtcaccggcctggaggag
gggcagctggttgcaatctctccgtccaggccctgtcagtcctgcaggttctgccatgcg
ggtcagcacaatcattgtctgaacatgcgcttttacggctcggccatgcccttcccgcat
atccagggggcgtttcgcgaaaaactggtggcggatgcgacccaatgcgtgcccgccgag
ggcctcagtgctggtgaagcggcgatggcggagccgctgtcggtctgtctgcatgccgcc
aagcaggcgggtgatatcatgggcaagcgggtgctcgtgactggatgcggcccgatcggc
ctgcttgtgatcctggtggcgcgtgccgctggtgcggcagaggtggtggcgacggacctt
acacctttcaccttgcaaaaggcccgcgagattggtgccgacctggccgtgaatgtagcc
gaggcatcagaccccttgagcgcgtttcaggctgacaggggtcattttgacgttcttttc
gaatgcagtggggctgccgccgctctggccagcgcagtgccggcgatgcgcccgggcggc
gtgatcgttcagcttggattggggggcgatatgaccctgccgatgcaggcgatgacggca
aaagaacttgagatacgcggctcctttcggttccacgcagagttcccgttggctgtcgag
atgatgcgaaaggggtttatagatgtgagccctctgatcacgcacagcttcgacatgaaa
gatgcggtgccagcgtttcagatggcatccgacaggtctcaggcaatcaaggctcagatc
cggttcggctga

DBGET integrated database retrieval system