KEGG   Thalassospira marina: CSC3H3_06470Help
Entry
CSC3H3_06470      CDS       T05224                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase FabI
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
thac  Thalassospira marina
Pathway
thac00061  Fatty acid biosynthesis
thac00780  Biotin metabolism
thac01100  Metabolic pathways
thac01130  Biosynthesis of antibiotics
thac01212  Fatty acid metabolism
Module
thac_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:thac00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CSC3H3_06470
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CSC3H3_06470
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CSC3H3_06470
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:thac01004]
    CSC3H3_06470
Enzymes [BR:thac01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     CSC3H3_06470
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     CSC3H3_06470
Lipid biosynthesis proteins [BR:thac01004]
 Fatty acid synthase
  Component type
   CSC3H3_06470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AUG52398
UniProt: A0A2N3KME3
LinkDB All DBs
Position
complement(1437154..1437984)
Genome map
AA seq 276 aa AA seqDB search
MSLSAENLSGLMAGKRGLIMGVANDKSIAWGIARAVAAAGGEVAFTYQGDALGKRVRPLA
ESIGSDIVLPCDVSDPASIDAAFDALKEKWETIDFIVHAIGYSDKNELRGRYLDTSPENF
AMSMNISVYSFTAVAQRAEKMMPNGGSMLTLSYYGAEKVMPHYNVMGVAKAALEASVKYM
ANDLGPDNIRVNAISAGPIKTLAASGIGDFRYILKWNEYNSPMRRNVTIDDVGHSGLYFL
SDLSSGVTGETHHVDCGYHTVGMKQVDAPDITVSKS
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgtccgccgaaaatctttcaggcctgatggccggtaagcgaggcctgatcatg
ggcgtcgccaacgacaaatccattgcatggggcattgcccgtgccgttgccgccgccggt
ggcgaggttgcatttacctatcagggtgatgcccttggcaaacgcgtgcgcccgctggcc
gaaagcatcggcagcgatatcgtgctgccctgcgatgtcagtgacccggcaagcatcgat
gcggcttttgacgcgttgaaggaaaaatgggaaaccattgacttcatcgtccatgcgatt
ggctattccgacaaaaacgaacttcgtggccgctatcttgatacgtcccccgaaaacttc
gccatgtcgatgaacatttcggtctattcgttcaccgctgttgcccagcgcgccgaaaag
atgatgcccaatggcggttccatgctgaccctgtcctattacggggcggaaaaggtcatg
ccgcattacaacgtcatgggcgttgccaaggcagcccttgaagccagcgtcaaatacatg
gccaacgaccttggcccggataatatccgtgttaacgcgatttcggctggcccgatcaag
acgcttgccgcatcgggcattggcgatttccgctatatcctgaaatggaacgaatataac
tcgccgatgcgccgcaacgtcacgattgacgatgttggtcattccggcctgtatttcctg
tccgacctgtcttcgggtgtgacgggcgaaacccaccatgtcgattgcggttatcacacc
gttggcatgaaacaggttgatgccccggacatcacggtcagcaagtcctga

DBGET integrated database retrieval system