KEGG   Thalassospira marina: CSC3H3_07715Help
Entry
CSC3H3_07715      CDS       T05224                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
thac  Thalassospira marina
Pathway
thac00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:thac00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CSC3H3_07715
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:thac02000]
    CSC3H3_07715
Enzymes [BR:thac01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CSC3H3_07715
Transporters [BR:thac02000]
 Other Transporters
  Pores ion channels [TC:1]
   CSC3H3_07715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_C_5 Tom37 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AUG52618
UniProt: A0A2N3KSD1
LinkDB All DBs
Position
1700914..1701606
Genome map
AA seq 230 aa AA seqDB search
MTAASKPELISFDLCPFVQRSVITLLEKNVEFDLTYIDLANKPDWFLAISPLGKVPVLRE
KGEVLFESAVINEYLDETNPPSLHPADPLKKAKNRAWIEVGGNQLMNSFRMMMSQTEEEY
NSHREALIKGFKLVEDQIEGPFFNGETFSLIDAAWAPIFTRLLIVEEALGEDYLPGYPKI
RAWAETLVARDSVINSVIDGFRDKFLTYLQNKTYNGDTPAYLAGRLAGSV
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgacagcagccagcaaacccgaactgatcagctttgatctctgcccttttgtgcagcgt
tcggtgatcacgcttcttgaaaagaacgttgaatttgacctgacctatattgatctggcc
aacaagccggactggtttttggcaatttcgccgctgggcaaggtcccggtcctgcgcgaa
aagggcgaagtcctttttgaaagcgcggtgatcaatgaatatcttgatgaaaccaatccg
ccgtcgctgcatcctgcggacccgctgaaaaaggcaaagaaccgcgcctggattgaagta
ggtggtaaccagttgatgaattccttccggatgatgatgtcgcaaacggaagaagaatat
aattcgcaccgtgaagccctgatcaaaggtttcaagctggtggaagaccaaatcgaagga
ccgttttttaacggcgaaaccttttcactgatcgacgccgcctgggcaccaatttttacc
cgcctgctgattgttgaagaagccctgggcgaagattacctgccgggttatcccaaaatt
cgcgcctgggccgaaaccctggtcgcacgcgatagcgtgatcaattcggtgattgatggg
ttccgtgacaagttcctgacctacctgcaaaacaaaacgtataacggtgatacaccggcg
tatctggcaggcaggcttgcgggcagcgtctga

DBGET integrated database retrieval system