KEGG   Thalassotalea sp. PS06: FNC98_04505Help
Entry
FNC98_04505       CDS       T06100                                 

Gene name
alaS
Definition
(GenBank) alanine--tRNA ligase
  KO
K01872  alanyl-tRNA synthetase [EC:6.1.1.7]
Organism
thap  Thalassotalea sp. PS06
Pathway
thap00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:thap00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    FNC98_04505 (alaS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:thap01007]
    FNC98_04505 (alaS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:thap03016]
    FNC98_04505 (alaS)
Enzymes [BR:thap01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.7  alanine---tRNA ligase
     FNC98_04505 (alaS)
Amino acid related enzymes [BR:thap01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   FNC98_04505 (alaS)
Transfer RNA biogenesis [BR:thap03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    FNC98_04505 (alaS)
 Prokaryotic type
    FNC98_04505 (alaS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2c DHHA1 tRNA_SAD Med10
Motif
Other DBs
NCBI-ProteinID: QDP00678
UniProt: A0A516HA99
LinkDB All DBs
Position
1037240..1039861
Genome map
AA seq 873 aa AA seqDB search
MIKSSAQIRQAFLDHFAKEQHQIVASSSLVPGNDATLLFTNAGMVQFKEAFLGQEQRSYT
RATSSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKQDAIRFAWSFLTETLQ
LPVEKLMVTVYETDDEAFAIWNEEIGVPADKIVRIGDKPGGKKFESDNFWSMGDTGPCGP
CTEIFYDHGEHIWGGPPGSPEEDGDRFIEIWNLVFMQFNRQADGTMDKLPKPSVDTGMGL
ERIAAIMQGVHSNYEIDIFQGLIKAAADLLDVKDLSHNSLKVIADHIRSCSFMIADGVMP
SNEGRGYVLRRIIRRAIRHGHKLEAKSHFFHKLVAALAEQMGEAYPELVKQQAVLEKILR
IEEEQFGRTLDRGMALLEDIISGLDSKQIAGADVFKLYDTYGFPADLTADIARERELTID
ESGFEQHMQAQRERAQQASQFGTDYNEQLKSEQHTNFRGYTNSDYSATVVELFNEEGQVS
TLSAGQKGVVVLDNTPFYAESGGQVGDTGVISTPNAEFEVTDTVKLGNAFAHHGIARGDI
QLNARVKASIDTERRSAIIKNHTATHLLHAALRQVLGEHVTQKGSLVDNEKLRFDFSHFE
GVTAEELRTIEQLVNQQIRNNSARETALMQIDEAKAKGAMALFGEKYDDEVRVVTLGDFS
TELCGGVHVDQTGEIGLFKITSEAGIAAGVRRIEAVTGEAALAFVDAQADTLDAISALVK
SDSSNALGKVEQMIQKAKQLEKEITQLKQKMAAQAGSDLVSNAIDINGVKALIANVEGSD
PKALRDMVDDLKNKLGSGIVMLGLANGPKVNLIAGVTKDLTAQVKAGELVNMVAQQVGGK
GGGRPDMAQAGGSQPENLDTALASVQAWLEAKL
NT seq 2622 nt NT seq  +upstreamnt  +downstreamnt
atgattaaatccagtgcccagattagacaggcatttttagaccattttgcaaaagagcaa
caccagatagttgccagtagttcgctggttcctggaaatgacgccaccttgttatttacc
aatgcgggcatggtgcagtttaaagaagcattcctgggtcaggagcaacgcagttacacc
cgcgccacatcgtcgcagcgctgtgttcgtgctggcggtaagcacaatgatttagaaaac
gtcggttatacggctcgtcaccacacattttttgaaatgctgggtaacttcagcttcggt
gattactttaaacaggatgcgattcgctttgcctggtcattcttaaccgaaacattgcag
ctgcccgttgagaagttgatggtcacggtttatgaaactgatgatgaagcctttgctatc
tggaatgaagaaattggcgtgccggcagacaaaattgttcgcatcggtgacaaaccaggc
ggcaagaagtttgaatccgataacttctggtcgatgggtgatactggcccatgtggtcct
tgtactgaaattttttatgatcacggcgagcacatctggggtggtcctccaggtagcccg
gaagaagacggcgatcgcttcatcgagatctggaacctggtatttatgcagttcaaccgt
caggccgacggtaccatggataaactgcctaagccttccgttgataccggtatgggcctt
gagcgtattgcggcaatcatgcagggcgttcattccaactatgaaattgatatcttccag
ggcttgattaaagcggctgcagatttacttgacgtaaaagacctgtctcataactcgtta
aaagttattgcagatcacattcgctcctgtagctttatgattgccgacggggtaatgccg
tcaaatgaaggtcgtggctatgtactgcgccgtattattcgccgtgcaatccgccatggt
cacaaactcgaagcgaaatctcatttcttccacaagctagtggctgcgttggccgagcaa
atgggtgaagcttacccagagcttgttaaacaacaagcggttctggagaaaatcctacgt
attgaagaagagcagtttggccgcaccctagaccgtggtatggcgttgcttgaggatatt
atttccggcttggacagcaagcagattgctggcgccgatgtattcaagctgtatgacaca
tatggcttcccggccgatttaaccgccgatatcgcccgtgagcgtgaattgaccattgat
gaatctggttttgaacagcacatgcaggcacagcgcgagcgtgcgcagcaggcgagccag
ttcggtaccgattataatgagcagttaaagtctgagcagcacactaactttaggggctac
accaatagtgattactcagcgacagtggttgagctattcaacgaagaaggtcaggtatcg
acattaagtgccggccaaaaaggtgtggtggttctcgataatacacctttctatgcggaa
tccggtggtcaggttggtgataccggtgtaattagtaccccgaatgccgaatttgaagta
accgatacggttaagttaggtaatgcttttgctcaccatggtattgcccgtggcgatatt
cagcttaatgctcgcgttaaagccagcattgataccgaacgtcgttctgcaatcattaaa
aatcatactgctacccacctattacatgccgctttgcgtcaggtgttgggggagcatgta
acccagaaaggttcattggtcgacaatgaaaaactgcgtttcgacttttctcactttgaa
ggtgtaactgccgaggagctgcgcactattgaacagctggtgaaccagcaaattcgcaac
aacagtgcccgtgaaacagctctcatgcagattgatgaagcgaaagctaaaggcgcgatg
gcgctctttggcgaaaaatatgatgatgaagttcgcgtcgtaacccttggggatttttct
actgagctttgtggtggcgttcacgttgaccaaaccggtgaaattggtttgtttaagatc
acctctgaagcgggtatcgctgctggtgtccgtcgtatcgaagcggtaacgggtgaagca
gcgctggcgtttgttgacgctcaggctgacacccttgatgctatttctgcattagtgaaa
agtgatagcagcaatgcccttggtaaagtggagcaaatgatccaaaaagccaagcagctg
gaaaaagaaattacccagcttaagcagaagatggcggcacaagccggctctgacttagtg
agcaatgcgattgacattaatggcgtgaaagccttgattgccaacgttgagggcagcgat
ccgaaagccttgcgtgatatggtcgatgacctgaaaaacaagctaggtagcggcatcgtt
atgcttggccttgctaatggtcctaaggtcaacctaattgccggtgtaaccaaagattta
accgcacaggtgaaagccggtgaactggttaatatggttgctcaacaagttggtggtaaa
ggcggtggtcgtcctgatatggctcaggctggcggtagccaacctgaaaatctggatact
gcattagcttccgttcaggcctggttagaagctaagctttaa

DBGET integrated database retrieval system