KEGG   Thalassotalea sp. PS06: FNC98_12580Help
Entry
FNC98_12580       CDS       T06100                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
thap  Thalassotalea sp. PS06
Brite
KEGG Orthology (KO) [BR:thap00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FNC98_12580 (ahpF)
Enzymes [BR:thap01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     FNC98_12580 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_oxidored FAD_binding_2 DAO Thi4 NAD_binding_8 AlaDh_PNT_C FAD_binding_3 Lycopene_cycl NAD_binding_7 K_oxygenase 3HCDH_N GMC_oxred_N Thioredoxin_9 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: QDP02099
UniProt: A0A516HEB6
LinkDB All DBs
Position
2844449..2846008
Genome map
AA seq 519 aa AA seqDB search
MLNNDILNALKAYTKNMANSVTLVLQPGDHPKRQELQDFIEKLCSVSDNLKWRTDTFDSG
LNSPLSFALEVDNELNGVIFSGIPAGHEFNSLILAILQSSGTSLKLDSSLQNLIKSVSAP
LHFEVFVSLSCHNCPDVVQALNQFALLNPHISSEMIDGGLYPELIEARNIQGVPSVYLNG
EPFANGKVDTAVLIEKLQQHLGDKLKSPANTEQLPTQDVTVIGGGPAGVSAAIYSARKGL
KVTLIADRIGGQVKDTVGIENLISVSQTTGTELTGNLISHMNDYDINLKEHIRVDKIEKG
DIKTLTLSSGEVLTTKTLIIATGAKWRELGVEGEKENIGQGVAYCPHCDGPFFKGKDVAV
IGGGNSGVEAALDLAGMVKSVTLFEFLPELKADKVLVEKAEQRDNITIIKSAKTEKILSD
GSKVTGIRYQDRNSEEIVDVDLDGVFVQIGLVPNSEFVDGLVERNAFGEIIIDEKGQTSE
PGIFACGDVTTVPYKQIVIAMGEGSKASLSAFDYLLRAA
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgctaaataacgatattctaaatgctttaaaggcttacactaaaaacatggcaaacagc
gtcactctggttttgcagccgggtgaccaccctaaacgtcaggaattacaggatttcata
gaaaaactgtgttcggtcagtgataacttaaaatggcgaacggatacgtttgactctggg
ttaaatagtccacttagttttgctctggaagttgacaatgagcttaatggcgtgattttt
tcaggcattcctgccggtcacgaatttaattcgttgatcctggcaatactgcaatcatca
ggcacgtcattaaaacttgatagcagtttgcaaaaccttatcaaatccgtttcagcgccc
ctgcactttgaagtgtttgtcagcctgtcatgtcacaactgtccggatgtcgttcaggca
ttaaatcagtttgcattattaaacccgcatattagtagtgaaatgatcgatggcggcttg
tatccagagcttatcgaagcgcgcaacatccaaggggtaccgagtgtttacctcaatggc
gaaccgtttgccaacggtaaagttgataccgcagtgttgattgaaaaactacaacagcac
cttggggacaagttgaaatccccggcaaacaccgagcagttaccgactcaggacgtaacc
gtaatcggaggcggcccggcgggagtttcagcggccatttacagtgcccgtaaaggtttg
aaagtaacgctaatcgccgatcgtattggtggccaggtaaaagacactgtgggtattgaa
aacctgatttccgtttcgcaaaccacagggacggaattaacaggcaatctgattagccac
atgaacgattatgacattaatcttaaagagcatattcgcgtcgataaaatcgaaaaaggt
gatatcaaaaccttaacgctctcaagcggtgaagtgttaaccaccaaaactctgattatc
gctactggcgccaagtggcgtgagctgggtgttgaaggcgaaaaagaaaacatcggccag
ggtgttgcttattgtccgcattgtgatgggccgtttttcaaaggcaaagatgtcgccgta
atcggtggtggtaactcaggtgtcgaagcggctctcgatttagcgggcatggttaaaagc
gtaaccttatttgaatttttaccagaattgaaagccgataaagtattggtcgaaaaagcc
gaacaacgcgataacatcactatcatcaaaagtgccaaaaccgaaaaaatactcagtgat
ggcagcaaggtcaccggtatccgttaccaggatcgcaatagtgaagaaattgtcgatgtc
gaccttgatggtgtgtttgtacaaatcggactggtaccgaattcggaatttgtcgatggt
ttagtcgagcgcaatgcctttggcgaaataatcattgacgaaaaaggacaaacctcagaa
cctggcattttcgcctgtggagacgtgacaaccgtaccatacaagcaaattgttattgcc
atgggagaaggttcaaaagcgtcgctatccgcgtttgattacttgttgcgcgcagcgtag

DBGET integrated database retrieval system