KEGG   Thalassococcus sp. SH-1: C6Y53_02625Help
Entry
C6Y53_02625       CDS       T05357                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
thas  Thalassococcus sp. SH-1
Pathway
thas00240  Pyrimidine metabolism
thas01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thas00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    C6Y53_02625
Enzymes [BR:thas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     C6Y53_02625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22
Motif
Other DBs
NCBI-ProteinID: AVO36695
UniProt: A0A2S0MLC4
LinkDB All DBs
Position
519124..519720
Genome map
AA seq 198 aa AA seqDB search
MAKLFFNYSTMNAGKTTVLLQASHNYRENGMQTYLLTAAIDGRAGRGRIASRIGIDAEAD
IFAPGDDLFARISRRLDQGPVACVFVDEAQFLEPGQVWQLARVVDDLNLPVLAYGLRVDF
RGELFPGSAALLALADEMREVRTICKCGRKATMVIRQDEAGNIITSGAQVQIGGNETYVS
LCRRHWREATGDRPAASA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctgttcttcaactactccacgatgaatgccggcaagacgaccgttctgttg
caggcatcgcacaattaccgcgaaaacgggatgcagacctacctgctgaccgccgccatc
gacgggcgggccggccggggccggatcgcgtcgcgcatcggcatcgacgccgaggcggac
atcttcgcgcccggcgacgacctgttcgcgcgcatctcccggcggctggatcaggggccg
gtcgcctgcgtgttcgtggacgaagcgcagtttctcgaacccggccaggtctggcaactg
gcgcgggtggtggacgatctgaacctgccggtactggcctacgggctgcgggtcgatttc
cgcggcgagctgtttccgggctctgccgcgctgctggcgctggcggacgagatgcgcgag
gtgcgcacgatctgcaaatgcggacgcaaggccacgatggtgattcgacaggacgaggcc
ggcaacatcatcacctcgggcgcccaggtgcagatcggcggcaacgaaacctatgtttcg
ctctgccgccggcactggcgcgaagcaaccggcgaccggcccgccgccagcgcctga

DBGET integrated database retrieval system