KEGG   Rhodobacteraceae bacterium SH-1: C6Y53_04195Help
Entry
C6Y53_04195       CDS       T05357                                 

Definition
(GenBank) 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
  KO
K15633  2,3-bisphosphoglycerate-independent phosphoglycerate mutase [EC:5.4.2.12]
Organism
thas  Rhodobacteraceae bacterium SH-1
Pathway
thas00010  Glycolysis / Gluconeogenesis
thas00260  Glycine, serine and threonine metabolism
thas00680  Methane metabolism
thas01100  Metabolic pathways
thas01110  Biosynthesis of secondary metabolites
thas01120  Microbial metabolism in diverse environments
thas01130  Biosynthesis of antibiotics
thas01200  Carbon metabolism
thas01230  Biosynthesis of amino acids
Module
thas_M00002  Glycolysis, core module involving three-carbon compounds
thas_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:thas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C6Y53_04195
  09102 Energy metabolism
   00680 Methane metabolism
    C6Y53_04195
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C6Y53_04195
Enzymes [BR:thas01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     C6Y53_04195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Metalloenzyme iPGM_N Phosphodiest Alk_phosphatase Sulfatase RHH_8
Motif
Other DBs
NCBI-ProteinID: AVO36977
UniProt: A0A2S0MMC7
LinkDB All DBs
Position
complement(851540..853063)
Genome map
AA seq 507 aa AA seqDB search
MTAPGPVVLCILDGWGLSDRPDANAPHLAKTPNFDAIMAGCPHATLVTHGPDVGLPAGQM
GNSEVGHTNIGAGRVVAMDLGQIDLAIEDGSFADRAALREFVATLQRTGGTAHLMGLVSE
GGVHAQLSHMIAAAGIIAGAGVPVALHAITDGRDVAPTSAPGYVDRLLVELPQGVRVATV
TGRFFAMDRDNRWDRVARAYRCMVRGEGQVAPDARAALAAAGDRGETDEFLAPTVIGDYA
GMQERDGLFCLNFRADRAREILAAIGQPDFDGFDTGPRPDLAARLGMVEYSEGHTAYMAT
VFPPRNIVNTLGAWVAKHGLRQFRLAETEKYPHVTFFLNGGKEDPEPGEDRFMPKSPAVA
TYDLQPEMSAPEVTDRFVAAIGAGYDLIVTNYANPDMVGHTGDLQAAMRACEAVDAGLGR
VCAALREAGGAMIVTADHGNCEMMVDPDTGGPHTAHTTNPVPVILVGGPDGATLRNGRLA
DLAPSLLDLMGLEQPAEMTGRSLIRHS
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgcccggacccgtcgtcctgtgtatcctcgatggctgggggctgtccgaccgg
cccgacgccaacgcgccgcatctggcgaagacgccgaatttcgatgcgataatggccgga
tgcccccatgcgacgctcgtgacgcacgggcctgacgtgggattgccggcggggcagatg
ggaaattccgaggtcggccacaccaatatcggcgcgggccgggtggtggcgatggacctg
gggcagatcgaccttgccatcgaggacggcagctttgccgaccgcgcggcactgcgcgaa
ttcgtcgcgacgttgcagcgcaccggcggcaccgcgcatctgatggggctggtgtccgaa
ggcggggtccacgcgcagctgagccacatgatcgcggccgccggcatcatcgccggggcc
ggggtgccggtggccctgcacgcgatcactgacggccgcgacgtggcgccgacctcggcg
ccgggctatgtcgacaggctgctggtggaactgccgcagggcgtgcgggtggcgaccgtg
accgggcgcttttttgccatggaccgcgacaaccggtgggaccgggtggcgcgggcctat
cgctgcatggtgcggggcgaggggcaggtcgcgccggatgcgcgggccgccttggccgcc
gccggtgatcgcggcgaaacggatgaattcctcgcgcccacggtgatcggcgactatgcc
gggatgcaggaacgcgacgggctgttctgcctgaatttccgcgccgaccgcgcccgcgag
atcctcgccgcgatcggccagccggatttcgacggcttcgataccggtccgcgccccgat
ctcgccgcgcggctgggcatggttgaatactccgagggccacactgcctatatggccacg
gtgttcccgccgcggaatatcgtcaacacgctgggcgcctgggtggcgaaacacgggctg
cgccagttccggctggccgagaccgagaaatacccgcatgtcacctttttcctcaacggc
ggcaaggaagacccggaaccgggcgaagaccggttcatgccgaaatcgcccgccgtggcc
acctatgacctgcagcccgagatgtccgcgcccgaggtcaccgaccggttcgtcgcggcg
atcggggcgggctatgacctgatcgtgaccaattacgccaatcccgacatggtcggccac
accggcgacctgcaggcggcgatgcgcgcctgcgaagcggtggatgccgggctgggccgg
gtatgcgcggcgctgcgggaggccgggggcgcgatgatcgtcaccgccgatcacggcaat
tgcgagatgatggtggacccggataccggcgggccgcataccgcgcatacgaccaacccg
gtgccggtgatcctcgtcggcggtcccgatggcgccacgctgcgcaacgggcggctggcc
gacctggcgccgagcctgctggacctgatgggcctcgaacagcccgccgagatgaccggc
cgcagcctgatccggcattcgtga

KEGG   Rhodobacteraceae bacterium SH-1: C6Y53_18445Help
Entry
C6Y53_18445       CDS       T05357                                 

Definition
(GenBank) histidine phosphatase family protein
  KO
K15634  probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
thas  Rhodobacteraceae bacterium SH-1
Pathway
thas00010  Glycolysis / Gluconeogenesis
thas00260  Glycine, serine and threonine metabolism
thas00680  Methane metabolism
thas01100  Metabolic pathways
thas01110  Biosynthesis of secondary metabolites
thas01120  Microbial metabolism in diverse environments
thas01130  Biosynthesis of antibiotics
thas01200  Carbon metabolism
thas01230  Biosynthesis of amino acids
Module
thas_M00002  Glycolysis, core module involving three-carbon compounds
thas_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:thas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C6Y53_18445
  09102 Energy metabolism
   00680 Methane metabolism
    C6Y53_18445
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C6Y53_18445
Enzymes [BR:thas01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     C6Y53_18445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AVO39477
UniProt: A0A2S0MUJ8
LinkDB All DBs
Position
complement(3820068..3820724)
Genome map
AA seq 218 aa AA seqDB search
MTREYRQHVYAPPPGACDMLLIRHGESQPAVPGESFPMTGGHGDPALHPDGEAQARAVGE
RLKGETLAAIYVTTLRRTHQTAAPLAAHLGLTPVVEPDLREVFLGDWDGGEYRIRAANGD
PAFARAKAGHEWGEIPGAETTAALHGRVRLGLERIAAAHADQRVAVFVHGGVVGAAMSIG
SGARPFAFNGAANGSISRIVIRGGDWDVRGYNDCAHLP
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtgaatatcgccagcatgtctatgcaccgccgcctggggcctgcgacatgctg
ctgatccgccacggcgaaagccagccggccgtgccgggcgagagctttccaatgaccggc
gggcatggcgacccggcgctgcatcccgatggcgaggcacaggcgcgcgccgtgggcgag
cggctgaagggcgagacgctggcggcgatctatgtcaccacgctgcgccggacccatcag
accgccgcgccgctggccgcgcatctggggttgacgccggtcgtcgaaccggacctgcgc
gaggtgttcctgggcgactgggatggcggtgaataccgcattcgcgcggccaatggcgac
ccggcctttgcgcgcgcgaaggcgggccatgaatggggcgaaatccccggcgcggaaacc
accgccgccctgcatggccgcgtgcgcttggggctcgagcgcatcgccgctgcccatgcc
gaccagagggtggccgtgttcgtgcatggcggcgtggtcggcgccgcgatgagcatcggc
agcggcgcccggccatttgccttcaacggcgcggccaacgggtcgatcagccgcatcgtg
atccgcggcggcgactgggatgtgcggggctacaacgactgcgcgcatctgccctag

DBGET integrated database retrieval system