KEGG   Rhodobacteraceae bacterium SH-1: C6Y53_08390Help
Entry
C6Y53_08390       CDS       T05357                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01715  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
thas  Rhodobacteraceae bacterium SH-1
Pathway
thas00650  Butanoate metabolism
thas01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:thas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    C6Y53_08390
Enzymes [BR:thas01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     C6Y53_08390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: AVO37722
UniProt: A0A2S0MP97
LinkDB All DBs
Position
1684537..1685313
Genome map
AA seq 258 aa AA seqDB search
MAFETIIVEVEDHVALIRLNRPDALNALNTQLLSELCTALEEADANDKVRCVIVTGSEKA
FAAGADIKEMSSMSFAEVFATNLFADPSDRLMKIRKPVIAAVAGYALGGGCELAMACDFI
IAADTAKFGQPEINLGVIPGLGGTQRLTRFVGKSKSMEMNLTGRFMDAEEAERAGLVSRV
VPAKKLMEEAQGTAQKIAEKSQPTVMAVKESVNRSYETTLNEGILFERRVFHSMFATEDQ
KEGMAAFMEKRQPQFRDK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggcctttgagacgatcatcgtcgaagtagaagaccacgtcgccctgatccgcctgaac
cggccggatgcgctcaacgcgctgaacacccagctgctgtccgagctctgcaccgcgctg
gaagaggccgatgccaatgacaaggtgcgctgcgtcatcgtgaccgggtccgagaaagcc
tttgccgccggcgccgacatcaaggaaatgtcgtcgatgagctttgccgaggtgttcgcg
accaacctctttgccgacccgagcgaccgtctgatgaagatccgcaagccggtgattgcc
gcggtggcgggctatgctctgggcggcggctgcgaactggcgatggcctgcgatttcatc
atcgccgcagataccgcgaaattcggccagcccgagatcaacctgggcgtgatcccgggc
ctgggcggcacccagcgcctgacccgctttgtcggcaaatcgaaatcgatggaaatgaac
ctgaccggccgtttcatggatgccgaagaagccgagcgcgccgggctggtcagccgggtg
gtgcccgccaagaagctgatggaagaggcgcagggcacggcccagaagatcgccgagaaa
tcccaacccaccgtcatggcggtcaaggagtcggtgaaccgcagctacgagaccacgctg
aacgaaggcatcctgttcgaacgccgcgtgttccattccatgttcgccaccgaggaccag
aaagaaggcatggccgccttcatggaaaaacgccagccgcaattccgcgacaagtaa

DBGET integrated database retrieval system