KEGG   Rhodobacteraceae bacterium SH-1: C6Y53_10680Help
Entry
C6Y53_10680       CDS       T05357                                 

Definition
(GenBank) phosphogluconate dehydratase
  KO
K01690  phosphogluconate dehydratase [EC:4.2.1.12]
Organism
thas  Rhodobacteraceae bacterium SH-1
Pathway
thas00030  Pentose phosphate pathway
thas01100  Metabolic pathways
thas01120  Microbial metabolism in diverse environments
thas01200  Carbon metabolism
Module
thas_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:thas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    C6Y53_10680
Enzymes [BR:thas01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.12  phosphogluconate dehydratase
     C6Y53_10680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ILVD_EDD zf-A20
Motif
Other DBs
NCBI-ProteinID: AVO38125
UniProt: A0A2S0MQG2
LinkDB All DBs
Position
complement(2155363..2157171)
Genome map
AA seq 602 aa AA seqDB search
MDLHPKLAEVTDRIRTRSAQSRAAYLDRMAQARDSGPARAHLSCSGQAHAYAGAGDDQQA
LATGKAGNLAIVTAYNDMLSAHQPFERFPALIRDAARSVGGTAQVAGGVPAMCDGVTQGA
AGMELSLFSRDVIAMAAAIALSHNTYDAAVFLGVCDKIVPGLVIAAQSFGHLPAVFLPAG
PMESGLANDEKAKVRQKFAAGEVGRDVLMAAEMAAYHGPGTCTFYGTANTNQMLMEFMGL
HLPGSSFVTPNTGLRDALTAAGARRALSLSALGNAYTPVCDILDERAFVNGIVGLNATGG
STNLLIHLIAMAAAGGIRLDWEDFADISEVVPLMARVYPNGLADVNHFHAAGGLAYVIGG
LLDAGLLHPDTRTVAGTGLAHYVAEPKLGPDGLRWEAGPRESHNDRILRPANDPFQPTGG
LKRLTGNLGTAVIKVSAVAPEHRVVEAPVRVFHDQEAVKAAFRAGELTGDLVAVVRFQGP
KANGMPELHSLTPILSVLQERGQKVALVTDGRMSGASGKVPAAIHVCPEALDGGPIARLR
DGDLLRVDAERGRIEILTEGVMNRDPATCDLSGNDRGCGRDLFTGFRQAVGAADAGATVF
RF
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atggatctgcatccgaaactggccgaggtaaccgaccgcatcaggacccgcagcgcgcaa
agccgggccgcctatctcgaccgcatggcgcaggcacgcgacagcggccccgcccgcgcg
cacctgtcctgttcgggacaggcgcatgcctatgccggcgcgggtgacgatcaacaggcg
ctggccaccggcaaggcgggcaacctggccatcgtcaccgcctataacgacatgctgtcg
gcgcaccagccctttgagcggtttccggcgctgatccgcgatgcggcccggtcggtcggc
ggcaccgcgcaggtggcgggcggtgtgcccgccatgtgcgatggcgtcacccagggcgcc
gccgggatggaactgtcgctgttttcccgcgatgtgatcgccatggccgccgcgatcgcg
ctgagccacaacacctatgacgccgccgtgttcctcggcgtctgcgacaagatcgtgccg
gggctggtgatcgccgcgcagagctttggccatctgccggcggtgttcctgccggccggt
ccgatggaaagcgggctggccaatgacgaaaaggcaaaggtgcgccagaaattcgccgcc
ggagaggtcgggcgcgacgtgttgatggccgccgagatggccgcctatcacgggccgggc
acctgcaccttctacggcaccgccaataccaaccagatgctgatggagttcatgggcctg
cacctgccgggctccagctttgtcaccccgaatacggggctgcgcgacgcgctgaccgcc
gcaggcgcgcggcgggcgctgtcgctttcggcgctgggcaacgcctatacgccggtctgc
gacatcctcgacgaacgtgccttcgtcaacgggatcgtcgggctgaatgccaccggcggg
tcgaccaacctgctgatccacctgatcgccatggccgccgccgggggtatccggctcgac
tgggaggatttcgccgacatctcggaggtggtgccgctgatggcgcgggtctatcccaac
gggctggcggacgtgaaccatttccacgccgccggcgggctggcctatgtgatcggcggg
cttctcgatgccgggctgctgcatcccgacacccgcaccgtcgccggcaccgggctggcg
cattatgtggccgaacccaagctcggccccgacgggctgcgctgggaggccgggccgcgc
gaaagccacaatgaccggatcctgcgcccggccaacgacccgttccagcccaccggcggg
ttgaaacggctgaccggcaacctgggcaccgccgtgatcaaggtctcggccgtcgccccc
gaacatcgcgtggtcgaggcgccggtgcgggtgttccatgaccaggaggcggtcaaggct
gccttcagggcgggggaactgaccggcgatcttgtcgcggtggtccggttccagggtcca
aaggcgaacgggatgcccgaactgcacagcctgaccccgatcctgtcggtcctgcaggaa
cgcgggcagaaggtggcgctggtcaccgacgggcgcatgtcgggcgcatccggcaaggtg
cccgctgcgatccatgtctgccccgaggcgctggacggcggccccatcgcgcggctgcgc
gacggcgacctgctgcgcgtcgatgccgaacgcggccggatcgagatcctgaccgagggc
gtgatgaaccgcgaccccgcgacctgcgacctgtcgggcaatgaccggggctgtggccgc
gatctgttcaccgggttccgccaggcggtcggcgcggccgatgccggtgccaccgtgttc
aggttctga

DBGET integrated database retrieval system