KEGG   Rhodobacteraceae bacterium SH-1: C6Y53_13905Help
Entry
C6Y53_13905       CDS       T05357                                 

Gene name
pdhA
Definition
(GenBank) pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
thas  Rhodobacteraceae bacterium SH-1
Pathway
thas00010  Glycolysis / Gluconeogenesis
thas00020  Citrate cycle (TCA cycle)
thas00620  Pyruvate metabolism
thas01100  Metabolic pathways
thas01110  Biosynthesis of secondary metabolites
thas01120  Microbial metabolism in diverse environments
thas01130  Biosynthesis of antibiotics
thas01200  Carbon metabolism
Module
thas_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:thas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C6Y53_13905 (pdhA)
   00020 Citrate cycle (TCA cycle)
    C6Y53_13905 (pdhA)
   00620 Pyruvate metabolism
    C6Y53_13905 (pdhA)
Enzymes [BR:thas01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     C6Y53_13905 (pdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh TPP_enzyme_C DXP_synthase_N
Motif
Other DBs
NCBI-ProteinID: AVO38677
UniProt: A0A2S0MS91
LinkDB All DBs
Position
2816841..2817830
Genome map
AA seq 329 aa AA seqDB search
MAARKSAKKPNISADELKTYYREMLLIRRFEEKAGQLYGMGLIGGFCHLYIGQEAVVVGL
EAAAEEGDKRITSYRDHGHMLACGMDAGGVMAELTGREGGYSKGKGGSMHMFSKEKHFYG
GHGIVGAQVPLGAGLAFADKYLGNGRVTFTYFGDGASNQGQVYETFNMAALWDLPVVFVI
ENNQYAMGTAQKRSTSTPDIYTRGEAFGIPGETVDGMDVLAVKAAGEKAVAHCRAGKGPY
ILEIKTYRYRGHSMSDPAKYRTREEVQKMREERDPIEHVRQMLLTGKHATEDDLKAIDKE
IKDVVNSAADFAKESPEPSVDELWTDIYA
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggctgcccggaaaagcgcaaagaaaccaaacatttccgcagatgagctcaagacctac
taccgcgagatgctgctgatccgccgattcgaggaaaaggccgggcaactctatggcatg
gggctgatcggcggtttctgtcacctctatatcgggcaggaggccgtcgtggtcgggctc
gaggccgccgccgaggaaggcgacaagcgcatcacctcctaccgggatcacggccacatg
ctggcctgcggcatggatgccggcggggtcatggcggaactgaccgggcgcgagggcggt
tattccaagggcaagggcggctcgatgcacatgttctcgaaagagaagcatttctacggc
ggccacggcatcgtcggcgcgcaggtgccgctgggggcggggcttgcctttgccgacaag
tatctgggcaacggccgggtcacgttcacctatttcggcgacggcgcctcgaaccagggt
caggtctacgagaccttcaacatggccgcgctgtgggacctgccggtggtgttcgtgatc
gagaacaaccagtacgcgatgggaacggcgcagaaacggtccacctcgacgccggacatc
tacacccgtggcgaggcgttcggcattcccggcgaaaccgtcgacggcatggacgtgctg
gcggtcaaggcggcgggcgagaaggcggtggcgcattgccgcgcgggcaaggggccctat
atcctcgagatcaagacctaccgctatcgcggccactcgatgtccgacccggccaagtac
cgcacccgcgaagaggtgcagaagatgcgagaggagcgcgacccgatcgaacatgtgcgg
cagatgctgctgaccggaaagcacgcgaccgaggacgatctcaaggccatcgacaaggag
ataaaggacgtggtgaattccgccgccgatttcgccaaggaaagccccgagccgtccgtg
gacgaactctggaccgacatctacgcctga

DBGET integrated database retrieval system