KEGG   Rhodobacteraceae bacterium SH-1: C6Y53_13910Help
Entry
C6Y53_13910       CDS       T05357                                 

Definition
(GenBank) pyruvate dehydrogenase complex E1 component subunit beta
  KO
K00162  pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Organism
thas  Rhodobacteraceae bacterium SH-1
Pathway
thas00010  Glycolysis / Gluconeogenesis
thas00020  Citrate cycle (TCA cycle)
thas00620  Pyruvate metabolism
thas01100  Metabolic pathways
thas01110  Biosynthesis of secondary metabolites
thas01120  Microbial metabolism in diverse environments
thas01130  Biosynthesis of antibiotics
thas01200  Carbon metabolism
Module
thas_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:thas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C6Y53_13910
   00020 Citrate cycle (TCA cycle)
    C6Y53_13910
   00620 Pyruvate metabolism
    C6Y53_13910
Enzymes [BR:thas01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     C6Y53_13910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr Transketolase_C Biotin_lipoyl Biotin_lipoyl_2 PFOR_II DUF3682 QRPTase_N Ribosomal_60s
Motif
Other DBs
NCBI-ProteinID: AVO38678
UniProt: A0A2S0MS01
LinkDB All DBs
Position
2817843..2819204
Genome map
AA seq 453 aa AA seqDB search
MATEILMPALSPTMEEGTLAKWLVKEGDTVSSGDILAEIETDKATMEFEAVDEGIVGRIL
IAEGTEGVKVNSPIAILVEEGEEVGDVAAGTAAPAAPAAQPVAPAPAAAAPEAPVVDQSP
DWPEGTAVKAQTVREALRDAMAEEMRSDETVYLMGEEVAEYQGAYKISQGLLDEFGDRRV
IDTPITEHGFAGIAVGSAFGGLRPIVEFMTFNFAMQAIDQIINSAAKTLYMSGGQMGCPM
VFRGPNGAAARVAAQHSQDYAAWYMQVPGLKVAMPYSASDAKGLLKSAIRDPNPVIFLEN
EILYGRSFDVPELDDFTVPFGKARIWREGDDVTIVSFGIGMQYALEAADRLAAEGISAEV
IDLRTLRPMDTGTVIRSVMKTNRCVTVEEGWPQGSVGSYISSVLMQEAFDWLDAPVINCT
GKDVPMPYAANLEKLALVTTDEVIAAVKQVTYR
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgaaatcctgatgcccgcgctgagccccaccatggaagaaggcacattggcg
aaatggctggtcaaggaaggcgacacagtgtcgtccggcgacatcctggccgagatcgaa
accgacaaggcgacgatggagttcgaggccgtcgatgaaggcatcgtcggcaggatcctg
atcgccgagggcaccgagggcgtgaaggtcaattcgcccatcgccatcctggtcgaagag
ggcgaggaggtgggcgacgtggctgccggaaccgctgctcccgccgcccccgcagcacag
cccgtagcacccgcgcctgctgccgccgcaccggaagcgcctgtggtcgaccagtcgccg
gactggcccgaaggcaccgcggtgaaggcccagaccgtgcgcgaggccctgcgcgacgcg
atggccgaagagatgcgcagcgacgagaccgtctatctcatgggcgaggaggtggccgag
tatcagggtgcctacaagatcagccaaggtctgctggacgaattcggcgaccggcgggtg
atcgacaccccgatcaccgaacacggctttgccgggatcgcggtcggctcggcctttggc
gggctcaggcccatcgtcgaattcatgaccttcaactttgccatgcaggcgatcgaccag
atcatcaactcggcggccaagacattgtacatgtccggcggccagatgggttgcccgatg
gtgtttcgcggccccaatggcgcggcggcccgcgtcgcggcccagcacagccaggactat
gccgcctggtatatgcaggtgccgggcctgaaggtggcgatgccctattcggcctctgac
gccaaggggctgctgaaatcggcgatccgcgacccgaacccggtgatcttcctggaaaac
gaaatcctctatggccgcagtttcgacgtgccggaactcgacgatttcaccgtccccttc
ggcaaggcccggatctggcgcgagggcgacgacgtgaccatcgtcagcttcggcatcggg
atgcaatacgcgctcgaggcggccgacaggctggccgcggaagggatttcggccgaggtg
atcgacctgcgcacgctgcggccgatggataccggcacggtgatccgttcggtgatgaaa
accaaccgctgcgtcacggtcgaggaaggctggccgcagggatcggtgggcagctacatc
tcgtcggtgctgatgcaggaggcgttcgactggctggatgcaccggtgatcaactgcacc
ggcaaggacgtgccgatgccctatgccgccaacctggaaaagctggcgctggtgaccacc
gacgaggtgatcgcggcggtcaagcaagtgacctatcgctag

DBGET integrated database retrieval system